current user: public

If you have questions about the server, please let us know.

Query: [E] COG0831 Urea amidohydrolase (urease) gamma subunit, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MQLTPQEKDKLLIFTAALVAERRKNRGLKLNYPEAVAYISAAILEGARDGNTVSELMSYGTTLLTRDDVMEGIAEMVHEVQVEATFPDGTKLVTVHNPIRLast
1 -71.500[E] COG0831 Urea amidohydrolase (urease) gamma subunit  ali  100  1MQLTPQEKDKLLIFTAALVAERRKNRGLKLNYPEAVAYISAAILEGARDGNTVSELMSYGTTLLTRDDVMEGIAEMVHEVQVEATFPDGTKLVTVHNPIR 100
2 -6.530[E] COG1446 Asparaginase  ali follow..  16  12...............AGAIARAQMSHEQELRYIQALSEIVESGQKMLEAGDSALDVVTEAVRLLEACPLFNAVYTRDGTHELDACVMDGNTVSHVRHPVL 108
3 -5.060[A] KOG1784 Small Nuclear ribonucleoprotein splicing factor  ali follow..  13  19..................TNDGRNIVGVLKGFDQATNIILDESHERVFSTKEGVQQHVLGLYIIRGDNIG.............................. 70
4 -4.830[S] COG3018 Uncharacterized protein conserved in bacteria  ali follow..  14  113........................SQALALAKRAAIVDGYRQLGEKMY-GIRVNAQDTVKDMVLQNSVIKTRVNALIRNAEIETIYKDGLCQVSMELKLD 188
5 -4.680[S] KOG4502 Predicted membrane protein  ali follow..  12  579.......MEFFVIIPFIPIEYLRINWGSRGNLLESTAFLALSTVLSIPIIIILVYLEFFQNYVLFIEEIFTYVMGFFVILET.................. 653
6 -4.610[E] KOG1592 Asparaginase  ali follow..  15  44..........VLVHAGAGYHSESKAKEYK----HVCKRACQKAIEKLQAGALATDAVTAALVELEDSPFTNSNLNLLGEIECDASIMDGKSLSGIKNPVS 141
7 -4.370[C] COG3630 Na+-transporting methylmalonyl-CoA/oxaloacetate decarboxylase, gamma subunit  ali follow..  27  55IQAENHDLERLRPVIVAAIAHHRRQQGLK....................................................................... 83
8 -4.310[S] COG2105 Uncharacterized conserved protein  ali follow..  9..LRHKQGNSHWMTNAQLLGDFSIDNYQLYSLGHYPGAVPG-------NGTVHGEVYRIDNATLAELDALRTRGGEYARQLIQTPYGSA........... 88
9 -4.290[D] KOG3431 Apoptosis-related protein/predicted DNA-binding protein  ali follow..  21  29.....TAKNGMISQILDQAAMQRLSN-LAVAKPEKAQMVEAALINMARRGQLSGKMTD.......................................... 80
10 -4.260[KB] KOG4161 Methyl-CpG binding transcription regulators  ali follow..  14  148VEVNETEQTLLVRFERNH--KLKVSPSTSGSFQEWMAIKSERLRQRLSN--RVLPVFELDEKCMARPRKFPGIRKLLGNDTYEVLFDDGYVKNVRAVHMN 247

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.