current user: public

If you have questions about the server, please let us know.

Query: [C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .
# Score Template Links and tools%idFirst MSIKTSHLKFKPRINEEIQNDIMRKAVVMAQERIGANRQKMVEELGHWEEWREHAKEIRNHVIENLDAYLYQLSEKVIQNGGHVYFAATAEDATNYIKNVAKQKNAKKIVKSKSMVTEEIGMNHVLEAEGIKVVETDLGEYILQVAEDKPSHIVVPAIHKDRHQIRKVLAEKLGYTGSDTPEEMTLFIRETIRNDFLEADIGVSGCNFAVAETGSVCLVTNEGNLRLATSLPKTHIAVMGMERLAPTFKEVDVLITLLARSAVGARLTGYNTWLTGPRLAGETDGPEEFHLVIVDNGRSKMLGSEFREVLRCIRCGACLNTCPAYRQIGGHGYGSIYPGPIGSVISPILGGYEEFKDLPSACSLCTACNQVCPVKIPLANLLLKHRRHIAESGMNPLAERLSVKAFTLANSHPSLWKIGMNVGAKVAKLAIRDGKMPIQVGAIAEWTKARDLPDAEGESFRSWFKNRLast
1 -137.000[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali  100  1MSIKTSHLKFKPRINEEIQNDIMRKAVVMAQERIGANRQKMVEELGHWEEWREHAKEIRNHVIENLDAYLYQLSEKVIQNGGHVYFAATAEDATNYIKNVAKQKNAKKIVKSKSMVTEEIGMNHVLEAEGIKVVETDLGEYILQVAEDKPSHIVVPAIHKDRHQIRKVLAEKLGYTGSDTPEEMTLFIRETIRNDFLEADIGVSGCNFAVAETGSVCLVTNEGNLRLATSLPKTHIAVMGMERLAPTFKEVDVLITLLARSAVGARLTGYNTWLTGPRLAGETDGPEEFHLVIVDNGRSKMLGSEFREVLRCIRCGACLNTCPAYRQIGGHGYGSIYPGPIGSVISPILGGYEEFKDLPSACSLCTACNQVCPVKIPLANLLLKHRRHIAESGMNPLAERLSVKAFTLANSHPSLWKIGMNVGAKVAKLAIRDGKMPIQVGAIAEWTKARDLPDAEGESFRSWFKNR 467
2 -36.800[S] COG1556 Uncharacterized conserved protein  ali follow..  15  1MLDQNNRQQFLDHLAKQLGREPRTQVVT--------------------EYHPLNDYPVTRLTELSLDQRCDAFVEFASQTMLVNCQVTTPEQATADLLAMCEKYGGGPVILNDDSRLVEAGITPAVQAKYETHIWSEN-------------------------------------------------AAEINRTFANTANIGIVFAEYGLTESGGIVLFSDAQRGRSVSLLPKVSIVVLNKSTILPRVAQLSEILH--QKAKQGERMPSCINLIAGPSSTADVHGPVAKAYLIIDDTKNVSVS.................................................................................................................................................................... 240
3 -25.900[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  11  3......................................................................................AVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTVDLNKCGPMVLDALIKIKNEV----------------DSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGK-----------------------------QYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTE-PFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKK....................................................................... 277
4 -25.200[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  22  36..................................................................................................................................................................................................................................................................................................................LSVQACYQCGTCTGSCPSGRR------TSYRTRLIMRKLQLGLVDEVIKSDELWMCTTCYTCYERCPRGVKIVDAVKAARNLAAKKGYMAKAHRMVAMFVIK........................................................... 131
5 -24.900[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  17  157..........................................................................................................................................................................................................................................................................................................SHEDRLKLDGLYECILCACCSTSCPSYWWNGDRYLGPAVLLQAYRWLIDSRDEATG-PFRLYRCHTIMNCAQACPKGLNPAKAIAEIKKMMVERR.......................................................................... 258
6 -19.500[C] COG1146 Ferredoxin  ali follow..  19  42...................................................................................................................................................................................................................................................................................................................DYDKCVTCGICFVTCGR-----------------RVFDFDKKEGKVIVARPYNCMVACQTCMNLCPTGISFPDAQNKIVKKAFEIIKPLLAEDHLSPKETETKPEP...................................................... 139
7 -19.300[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  14  17.......................................................................................................................................................................................................LFGSHGARLLAAQR--------EPKDIVEVPKGYVYVNNKELSMEFADITDRAASTMFFGELLRG------VTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGS-----------RRTTRYDIDMTKCIYCGFCQEACPVDA........................................................................................... 171
8 -19.100[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  10  113...............TAAHAGHARHLVDHLIERLGEDYKIDLGSNVDIEAITRTVMGKRPATLGDLREVMDYAEEQMSHLLSACHTGQEG-DSKDFESKAFHAGLMDDLTREVADLAQIVALDLPKGDEDAPLVELGFG----------------------TIDTEKPVVLCIGHNVLPGADIVDYLDENEMEDQVEVCGICCAAIDVTRYNEAAKVVGPRSGVADVIVVDEQLEEALKNRSAVIATTDKMCLGLPDMTDEDPDKIVNDLINLILDPEKVGEVAVKTAMKLAPIRKSLKKLIDEIIELASECTDCGWCQRVCPNSLPVMD----------AVKKAADGDLSKLEEMAIEELCYTCGRCEQECERNIPIVSMVTKAGERRVKDE.......................................................................... 480
9 -18.800[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  25  116......................................................................................................................................................................................................................................................................................................................NCIGCTKCIQACPV------------------DAIVGATRAMHTVMS--DLCTGCNLCVDPCPTHISLQPVAETP.................................................................................. 171
10 -17.900[C] COG1145 Ferredoxin  ali follow..  11  1MHHSHHLEIY-EKLREKLNKTVSGVEKELLSVLFDEEEAKIAVHMPFIRFTAEQLAERTGKSLEYVEKILNEMAKKGEKDGQTYYRLPRQEKLARLWSQYRKEGFLDEIGDREHPIMRALPERDTISEKSEILPYEDAVKLVKE---------------------------------RDYIAVGYCPCRVMARLVGEGCRHSIENC---IHMGSVGKYMVEHGLGRRISA-----------DEAIEILRQSNREGLVHLTERSKHVATICNCCSDCCVFFKAVHEAKHPNTIAHSSYLATVDTS------RCIACGICMLRCP-----------------MKAIKAKINREPASVDA--EKCLGCGVCVPTCPMEA---ELVERDELLELPDGMTYVQELLADK............................................................... 360
11 -17.800[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  22  49...................................................................................................................................................................................................................................................................................................................DESKCVKCYICWKFCPEPAIY--------------------IKEDGFVAIDYDYCKGCGICANECPTKITMVR....................................................................................... 102
12 -17.300[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  18  5................................................................................................................................................................................................................................................IINVVHGTFTQLRSLVMIFGHAFRKRDT--------------LQYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETEDGRWYP-----------EFFRINFSRCIFCGLCEEACPTTA........................................................................................... 115
13 -16.500[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  19........................KAAIKIIGDNTDLYAQGYFSYDSKKSGGLTVSHLR------FGENRIRSAYLIQQADFVSCSTSAYLRSYDLLKGLKPGG---TFLLNTIWEGEQLAMREYIAKNNIQFYTLNAMRIAGEAGLGRRINTVMQTAFFRVTDILPF-------------EKALADLKASAIATYGKKDMAVAEKNILAMDQTKVEVPESWANPVLTAEASTATEKPAYVKNILEPVNRLEGDNLTVGDLISNGMVSGAYPPGTAAYEKRGIALEVPE------------------ISENCTMCNECAFVCPHAAIRPILTNEEEMESAPEGFMTREMRGKDGLRYRIQVCTGCNLCAETCPAKDKALVMKPFEEVAAKENPNWSFAINV.................................................................. 371
14 -15.500[C] COG0348 Polyferredoxin  ali follow..  20  211........................................................................................................................................................................................................................................................................................................GAKGLFRIKVEHRQQCDNCMDCYNVCPEPQVLRDPLHAKKSESPLVLSKD---------------CISCGRCIDVCPEKV----FIFTTRFNHSVNHS......................................................................... 289
15 -14.200[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  24  81......................................................................................................................................................................................................................................................................................................................LCVSCKLCGIACP-FGAINANTPKAPPAPPAPARISTLLDWVPGIRAIAVKCDLCSACVRMCPTKADIARVSKRKRELTFNTD.......................................................................... 187
16 -13.900[R] COG1453 Predicted oxidoreductases of the aldo/keto reductase family  ali follow..  12  33..................................................................EERATRQVRYAIDQGVNYVDTAWMGESEPFLGRALADGYREKVKLATKLPSWMVKLNAQLEKLKTDHIDYYLIHNLSGETWDRIEALNVIDFFEKAKSDGRI--VNAGFSFHGLANDFKRIVDAYPWTFCQKHQAGTEGLKYAASKGLGVMIMEPLRGGNLARTVPLAIENIWSEADVERTPVEWALRWVWNH--------PEVTVVLSGMNEEVHIKENLKIASEAYPNSLTEAELQLVSKVEQCTGCQYCMP-CPIYNHLSTFGNAEDANLLYIGLLSGAVSGGKP--GMASQCVQCGQCLEKCPQHIDIPTILESVAEELEGSD.......................................................................... 384
17 -13.000[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  14  128..RQRDKMALLDRIHQALGGAGFPTASKLQGGL--NGIITLIINAAECEPYITADDRLMQEHADEVITGIHILRHLLQPQQVLIGIEDNKPEAIAALQRALRGQDDIHLVPTKYPSGGAKQLTKILTGKEVPFHSSSIGVLMQNVG--------------TVVAIKRAVID------------------------------DEPLIERVVTLTGDAL--SSPGNFWARIGTP--------VLYLLKLA---------------GFKPQNPPMVIMGGPLMGFTLPSLDVPIVKISNCPAETEMGLSEPEQSCIRCGLCVDACPAGLLPQQLYWFSRGE-----------EHEKARNHNLFDCIECGACAYVCPSNIPLVQYYRQEKAEIRAL........................................................................... 446
18 -12.300[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  11  3..................................................................................DVFYTSTRAEV---TDPAKWYQPDLSAVRKLEKLIDESGVLDVVSKGDVVAVKTHFGDRGTTRTLRSVFIRTVVEKVIEAGGRPFVTETTGLGMLRP-----------RCTAVGRINIAEENGYTHQTLKAPIIIADGLLGFDYVEVPVEGKHLNSVKVAKAIAECDAVICCFKLHMQAGVGGSIKNVGVGCVAKPSKFDIHMSDYPQI----------------DEEKCTKCDECVKICPS-------------------------NAIEDYQINREKCVKCLGCSEACDYG............................................................................................ 242
19 -12.200[C] COG1141 Ferredoxin  ali follow..  21  50...................................................................................................................................................................................................................................................................................................................DEITCIGCKHCAHVARTFY------------------IEPDYGRSRVIRQDGDAEEVIQEAIDTCPVDIHWVD....................................................................................... 106
20 -12.200[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  24  65.....................................................................................................................................................................................................................................................................................................................ISCNHCPACTKVCPSGAMHKRE--------------------DGFVVVDEDVCIGCRYCHMACPYGAP.......................................................................................... 114
21 -11.900[C] COG2440 Ferredoxin-like protein  ali follow..  13  11...............................................................................................................................................................................................................................................................................................EEKLYQNRYLVDPGRPHIKVRPHERPSALALTHICPAKCYELND--------------------KGQVETTSDGCMECGTCRVLCEASGEIV........................................................................................ 84
22 -11.500[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  15  14.......................................................................................................................................................................................................................................................................................................................CAACGACEAVCPIGAVTVKKAAG---------IRDPNDLSLYEKGGGYQVCEGCLTCSRVCPVVDGFIQ-VRKFFGARSKDNVGSQDGGVASGILKSLFKQGKI----CAVGITRNEKWEPEVVLLTSAEDVERTRGTKYTSDPVLAALREAFEK. 160
23 -11.100[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali follow..  10  11........PISGSPEQVIRDGNAITEVALLGEEYVGMRPSMKVREGDTAPASGTVTAIHRGAKRVLQSVVIKIEGNEQITFEKYTTEQLNQLTSEQVRQNLQASGLWTALRTVSIFVNAMDTNPLCADAGLTVLSRLHEGKVYLCKAANASIPSPSIANLDVKEFAGPHPAIHFIDPVSATKFVWYINYQDVIAVGKLFTTGELDVSRVVSLAGPQVKNPRLVRTVLGANLSQLTANEVKDGRVISG-----SVLSGAKAAGPVDYLGRYALQVSVLEEGREKESLSRTVLGHFSKKLFNFTTALNGGERAMVPIGAYERVMPL---------------PTLLLRDLAAGDTDSAQALCLELDDLALCTFVCPGKNEYGPLLRQALDKIEKEG.......................................................................... 446
24 -10.700[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  252.............IACGLSYAYTKEALENLNLNLPVLKLSSMHPLPE-RLIENFVSQMKKVIV--VEEVDPFVELHVRAMGLAEVYGKNVGRVETGIAKALGIKPSRDYEGIVAESQKLAAIRRVVDELGDAALPSDIGCYTLGINKPLEGVDITICMGASVGVSNGL-NKIIATIGDSTF-----------AGIPPLINAVYNHADLVILDNSTTGMTGHQPHPGTGFRGCGEAGKAVRIEDIVRGCGEFVEVVNPYNVRKMVDVLRRALNH-------------DGVAVVIARQPCAILWSRARRRTEDCTLCMECVNTCPALIFDGEKVSIDQ-----------------------SLCVGCAVCAKICPNRA........................................................................................... 616
25 -10.300[C] COG1600 Uncharacterized Fe-S protein  ali follow..  78......................................................................................................................................................................................................LRVISVRMNYLPANAAFASTLKDPTLGYVSRYARDYHKLLRSLKKLGEQIQQYCGSLNFRPFVDSAPILERPLAEKAG-KHSLILNREAGSFFFLGELLIDLPLPVDQPVEEGCGKCVACMTICPTGAIVEPYTVDARRCISYLTIELEGAIPEAFRPLIGNRIYGCDDCQLICPHNPDLLELFSWSEAQFLKVTEGSAIRRIGHLRWLRALGNAPWSNAVITALESRKG--------HPLLDEHIEWAIAQQIEKRNACIIEVQLPKK 369
26 -9.920[R] KOG4602 Nanos and related proteins  ali follow..  17  233..........................................................................................................................................................................................................................................................................................................................CNFCKHVCPILRHY--------------------------------VCPVCGATGDQCPLNGGQQSLYRRSGRNSAGRR.......................................................................... 305
27 -9.380[C] COG1140 Nitrate reductase beta subunit  ali follow..  19  216......................................................................................................................................................................................................................................................................................................................KCRGWRMCITGCP-YKKI------------------------NWKSGKSEKCIFC-VCSETCVGRIRYLGVLLYDADAIERAASTENEKDL.................................................................. 292
28 -9.070[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  24...............................................YVHYKRTAKVLKAAPQYNIDGDLKSVVERQRDKKIPYAVIRGTVTPIGVPLRSSLVPSVSGVLQIVKLHEHRVTRGFA-SANEMPFELRNQSHGVEIVDALSAAVLDVDVVYDNYEPSNLSLFDHVFGFFSGVRQRGLQTTEEVLR-----EGSFLTAIGELELDGDTLRMQPSNEG--------PLFLTTATKSTLIKRFEDAKTTTILKLTISAILVAFIAKKLYRKRKQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVC--CGHVC--------------------------------------LCEDCAKISVTCPVRGSIVSKAAAFIA................................................................................ 338

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.