current user: public

If you have questions about the server, please let us know.

Query: [C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MIKEIINVVHGTFTQLRSLVMIFGHAFRKRDTLQYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETEDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEFKRQDLVYEKHDLLISGPGKNPDYNYYRVAGMAIAGKPKGAAQNEAEPINVKSLLPLast
1 -81.900[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali  100  1MIKEIINVVHGTFTQLRSLVMIFGHAFRKRDTLQYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETEDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEFKRQDLVYEKHDLLISGPGKNPDYNYYRVAGMAIAGKPKGAAQNEAEPINVKSLLP 182
2 -64.100[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  35  68...........FGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNGDKWESEIASNLQADHLYR..................... 217
3 -28.900[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  32  114..........................................................ENNCIGCTKCIQACPVDAIVGATRAMH---------TVMSDLCTGCNLCVDPCPTHCISLQPVAETPDSWK..................................................... 175
4 -28.000[C] COG1146 Ferredoxin  ali follow..  18  42.........................................................DYDKCVTCGICFVTCGRRVFDFDKKEGK------VIVARPYNCMVACQTCMNLCPTGAISFPDASYIKKLVAQNKIVKKAFEIIKPLLAEDHLSPKETETKPEP..................... 139
5 -27.400[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  33  49.........................................................DESKCVKCYICWKFCPEPAIYIKEDG---------FVAIDYDYCKGCGICANECPTKAITMVREEK........................................................... 105
6 -24.200[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  29  274.........................................................ISENCTMCNECAFVCPHAAIRPILTNEEEMESAPEGFQVSPMDCTGCNLCAETCPAKALVMKPFEEVAAKENPNWSF................................................ 367
7 -23.400[C] COG1145 Ferredoxin  ali follow..  29  285.........................................................DTSRCIACGICMLRCPMKAIKAKINRE--------PASVDAEKCLGCGVCVPTCPMEAIELVERDELLELPDG.................................................... 349
8 -22.800[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  32  200.........................................................DEEKCTKCDECVKICPSNAIE--------------DYQINREKCVKCLGCSEACDYGAVKTFWVFGRDVSER..................................................... 257
9 -21.400[C] COG0348 Polyferredoxin  ali follow..  15  179..............WLVLAVFLFDLFIVEHGWCGHLCPIGAAYGVIGAKGLFRIKVEHRQQCDNCMDCYNVCPEPQVLRDPLHAKKSESP----LVLSKDCISCGRCIDVCPEKVFIFTTRFNHSVNHSGE................................................... 291
10 -20.500[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  18  136...........IKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDLYRCHTIMNCTRTCPKG.................................................................... 256
11 -20.100[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  20  47..................APQLCHHCEDAPCAVVCPVNAITRVD---GAVQL-----NESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPAVKCDLCSACVRMCPTKALHLVDNTDIARVSKRKRELTFNT............................................ 186
12 -19.900[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  16  121..............VVKDLVPDLSNFYAQHRSIELKTVSPTPAKEWKQSHEDRLKLDGLYECILCACCSTSCPSYWWNGDRYLGPAVLLQAYRWLIDLYRCHTIMNCAQACPKG.................................................................... 240
13 -19.300[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  25  10.........................................................DYDVCAACGACEAVCPIGAVTVKKAAGIRDPNDLSLYEGGYQVCEGCLTCSRVCP...................................................................... 66
14 -19.200[C] COG1141 Ferredoxin  ali follow..  10  1..................MADFLPSPEQEDNRSGFEPERSGFEPELGGILRQKGVYVDEITCIGCKHCAHVAR-NTFYIEPDYG-----RSRVIRQDGDAEEVIQEAIDTCPVDCIHWVDYTELKNLEEDRKFQVIPVVGYPVDHAVATTEKRRRKQKSKNKKSR................. 151
15 -18.500[C] COG1600 Uncharacterized Fe-S protein  ali follow..  13  114..DYHKLLRSRLKKLGEQIQQYCGSLNFRPFVDSAPILERPLAEKWTGKLPLPVDQPVEEGCGKCVACMTICPTGAI-------------VEPYTVDARRCI-CDDCQLICPWNRYSQLTDEADFSPRKALHNPDLLELFSWSEAQFLKVTEGSAIRRIGHLRWLRNVAVALGNAPWSNAVI 329
16 -18.000[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  22  63..................LSISCNHCDDPACTKVCPSGAMHKRED--GFVVV-----DEDVCIGCRYCHMACPYGAPQYNAEKGH------------MTKCDGC-ICVESCPLRALEFGPIEELRQKHGT.................................................... 164
17 -17.800[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  16  296VVTLTGDALSSPGNFWARIGTPVLYLLKPMVIMGGPSLDVPIVKISNCILAPAETEEPEQSCIRCGLCVDACPAGLLPQQLYWFSRGEEHEKARNHNLFDCIECGACAYVCPSN-IPLVQYYRQEKAEIRALDQESARAAEAKARFEAKQARLAREKLARELRHKQAAVKLTDADQ...... 490
18 -17.500[Y] KOG2439 Nuclear architecture related protein  ali follow..  11  1.............................................MSALLSESDLNDFISPALACVKPTQVSGGKKDNVNMNGEYEVSTEPDQ-SITLSDCLACSGCITSSEEILLSSQSHSVFLKNWGKLSQQQDKFLVVSGTEMGRIISISKTVEKIIAHKKQKENTGADRKPLLSAVCP 178
19 -17.500[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  22  37.........................................................SVQACYQCGTCTGSCPSGRRTMRKLQLGLVDEVIKSDEL---MCTTCYTCYERCPRGV................................................................... 99
20 -17.300[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  18  241....MERLAPTFKEVDVLITLLARSAVGARLTTDGPEEFHLVIVDNGRSKMLGSEFREVLRCIRCGACLNTCPAYRQIGGHGYGSIYPGPIEEFKDLPSACSLCTACNQVCPVKI................................................................... 376
21 -17.200[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  11  352....PDKIVNDLINGNIEGALILDPEKVGEVAVKTAMKLAPIRKSLKKLPDIDEIIELASECTDCGWCQRVCPNSLPVMDAVKKAADGDLSKLEEMAEELCYTCGRCEQECERN-IPIVSMVTKAGERRVK................................................... 478
22 -16.700[C] COG2440 Ferredoxin-like protein  ali follow..  22  32..........................................................PHERPSANLLTHICPAKCYELNDKG---------QVETTSDGCMECGTCRVLCEASG................................................................... 81
23 -16.100[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  26  144.........................................................DPDQCILCGRCVEACQNETLSIDWERSQPRVIWDDDRPANLSSCVSCGLCATVCPCNALM................................................................. 207
24 -15.300[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  26  598.........................................................DSDVCGGCEVCIELCPFGAISIEEGHA----------NVNVALCKGCGTCVAACPSGAM------DQQHFRTEQIMAQIEAALNEQAK..................................... 669
25 -14.900[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  15  12.........................................................FADLPKDNKKCIKIGSPLALSLS-------------------DCLACSGCVSADEAGALSEDLSFVLDLSPQTSFVLSPQSKIN......................................... 76
26 -14.900[C] COG1036 Archaeal flavoproteins  ali follow..  17  181.........................................................ELLKCKGCGICKELCPYNAIKGGPVEVL------------VRDVDMRGITVLESPEAILEL................................................................ 238
27 -14.800[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  22  526.....RKMVDVLRRALNGVAVVI-----------ARQPCAILWSRARRREGKIVTYKVTEDCTLCMECVNTCPA-------------IFDGEKVSIDQSLCVGCAVCAKICPNRAIKPAKS............................................................. 622
28 -14.800[C] COG1140 Nitrate reductase beta subunit  ali follow..  17  180..................LPRLCEHCLNPACVATCPSGAIYKREE--GIVLI-----DQDKCRGWRMCITGCPYKKIYFNWKSGK------------SEKCIFC-VCSETCVGRIRYLGVLLYDADAIERAASTENEKDL.......................................... 292
29 -12.600[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  19  70...........MTPASDGTFISFRESVVEWLMTNHPHD----FRRYRFTKRTHRNQDEMNRCIACYRCVRYYKGTDLGVYGAHDNVYFGRPEDGTLE---SEFSGNLVEICPTGVFT................................................................. 209
30 -12.300[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  19  14..........GKTTFSATIHALEGGVVAD-CDVDAPNLHILLKPQILKAEDFIASKKMPEKCSSCGLCYDLCRFGAVVAE-----------DGYYVDEKKCEGCAFCFNVCPERAIEMEN.............................................................. 114
31 -12.200[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali follow..  15  345.......................KYSLSRTVLGHFSKKLFNFTTALNG---------GERAMVPIGAYERVMPLDIIPTLLLRDLAAGDTDSAQALGCLELD-LALCTFVCP-------GKNEYGPLLRQAL.................................................. 439
32 -12.100[R] COG1453 Predicted oxidoreductases of the aldo/keto reductase family  ali follow..  18  243.........PEVTVVLSGMN-EEVHIKEKIASEAYPNSLTEAELQLVSKVEQKYRQIMKVGCTGCQYCMP-CPSG-VNIPESTFGNAEDANLLYI-MASQCVQCGQCLEKCPQH.................................................................... 366
33 -11.300[C] KOG2282 NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit  ali follow..  10  93...........AMPVMKGWNILAREGVMEFLLANHPLD----RSRFLEGKRAVEDKNIMTRCIQCTRCIRFAEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALT................................................................. 232
34 -10.800[C] KOG2415 Electron transfer flavoprotein ubiquinone oxidoreductase  ali follow..  26  555.................................................................GPEQRFCPAGVYEFVPVEQGDGFR----LQINAQNCVHCKTCDIKDPSQNINWV............................................................... 604
35 -9.500[QR] COG0500 SAM-dependent methyltransferases  ali follow..  12  8...................................................ISRDHSTVQARTGCRLCGKLLRHSFVDLGMSTAERLDHMEPYYPLHAQVCDHCFLVQLKEYFSPADICTEYAYFSSFATSWVSHAKNYCDE........................................ 105
36 -9.350[S] COG3592 Uncharacterized conserved protein  ali follow..  14  24.........................................................NTNICAHSGNCVKGNA-ELFNLDRKPWIMPDNVPKEEAKR---------VIHTCPSGALQYIEK............................................................. 77

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.