current user: public

If you have questions about the server, please let us know.

Query: [T] COG1217 Predicted membrane GTPase involved in stress response, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .
# Score Template Links and tools%idFirst MIENLRNIAIIAHVDHGKTTLVDKLLKLSGTLDRKEAESERVMDSNDQEKERGITILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDLFDNLGATDEQLDFPIVYASALNGIAGLDHEKMDDNMDALFQAIIDHVPAPVVDTEGPFQMQISQLDYNSFLGVIGIGRITRGKVKSNTPVVAISDDGSKRNGRILKIMGHHGLQRVEVAEAEAGDIVCVSGMEELFISDTLCDPQNVEALPPLTVDQPTVSMTFQVNDSPFAGREGKFVTSRNIKERLEKELLHNVALRVEPGDSPEKFKVSGRGELHLSVLIETMRREGFELAVGRPEVVIIEKDGEKQEPYENVTIDIEEQHQGSVMEQMGLRKGDLSNMIPDGKGRVRLEYTIPARGLIGFRNNFLTLTSGTGILTSTFSHYGPIKAGEVSNRQNGVLVSMATGTALTYSLETLQSRGKLFLGPGDEIYEGQLAGINSRDNDLVINPTKGKKLDNMRASGKDEVIALVPPIRFTLEQALEFIADDELVEVTPKSIRLRKKMLNENDRKRYERSKVLast
1 -167.000[T] COG1217 Predicted membrane GTPase involved in stress response  ali  100  1MIENLRNIAIIAHVDHGKTTLVDKLLKLSGTLDRKEAESERVMDSNDQEKERGITILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQIFDLFDNLGATDEQLDFPIVYASALNGIAGLDHEKMDDNMDALFQAIIDHVPAPVVDTEGPFQMQISQLDYNSFLGVIGIGRITRGKVKSNTPVVAISDDGSKRNGRILKIMGHHGLQRVEVAEAEAGDIVCVSGMEELFISDTLCDPQNVEALPPLTVDQPTVSMTFQVNDSPFAGREGKFVTSRNIKERLEKELLHNVALRVEPGDSPEKFKVSGRGELHLSVLIETMRREGFELAVGRPEVVIIEKDGEKQEPYENVTIDIEEQHQGSVMEQMGLRKGDLSNMIPDGKGRVRLEYTIPARGLIGFRNNFLTLTSGTGILTSTFSHYGPIKAGEVSNRQNGVLVSMATGTALTYSLETLQSRGKLFLGPGDEIYEGQLAGINSRDNDLVINPTKGKKLDNMRASGKDEVIALVPPIRFTLEQALEFIADDELVEVTPKSIRLRKKMLNENDRKRYERSKV 605
2 -113.000[M] COG0481 Membrane GTPase LepA  ali follow..  21  1.MKNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDR-EMEAQVLDSMDLERERGITIKAQSVTLNYKTYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSAKTGVGIE-----------------DVLEEIVHKIPAPEGDPNAPLQALIIDSWFDNYLGVVSLVRIKNGTLRKGDKIKVMSTGQSYNVDRLGIFTPKQVDTTILNCGEVGWVVCAIKDILGAPVGDTLTSHNNPASSVLPGFKKVKPQVYA-------GLFPISSDDYEAFRDALGKLSLNDASLFYEPENSTAGFRCGFLGLLHMEIIQERLEREYDLDLITTAPTVVYEVETEIREPIAECNMLLPQTYLGNVITLCVEKRGVQTNMVYHGNQVALTYEIPMGEVVLDFFDRLKSTSRGYASLDYGFKRFQAADMVRVDIMINGERVDA---LALIVHKDNAPYRGRELVEKMRELIPRQQFDIAIQA----AIGNHIIARSTVKQLRKNVLA-----------------------KCYGGDVSRKKKLLQKQKEGKKRMKSL 578
3 -110.000[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  20  39.PDKIRNFGIVAHVDHGKSTLADRLLEMCGAVPPG---QKQMLDKLQVERERGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEKNIQIIPVINKIDLPGADIKSVETQLKNLFEFNPEECLHISAKSGLNVD-----------------KVLEAIIDRVPAPTAIIDAPFRSMIFDSYFDHFRGAIAHIMVKEGSVKKGDKIQSYQNEKVYDVSEVGVMRPEMVKCTELRAGQVGYLVCNMRTVNEAVVGETLFAETTSRDS-----VKTFAEIKGVKPTVYAGLFPVETSDYESLKQAVERLCLNDPSVTVIPDSSKAGWRIGFLGVLHMEVFGARLSQEYASVILCQPSVEYRAKIKDFLEPMVKVRMIVPNEMMGTVNGLCSECRGERGEITSIDSTRLVILWRLPLAEVVDFFERLKKLTSGYASFDYEPDGWQDTRLVKLTILINSKEVSE---FSQIIPAAMARDRAKILVQRLKREIPRQQFEVTIKA--CIGSSTKALSQIVIQPMKRDFSQLLKG-------------------NFGGGGMERLNKKLSHQKKGKERMKMV 629
4 -94.700[J] COG0480 Translation elongation factors (GTPases)  ali follow..  22  7.LEKVRNIGIAAHIDAGKTTTTERILFYSGIIHKEVHEGTAVTDWMDQERERGITITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGANFYRVHEQMRD---RLRANAIAIQLPIGSENDFKGIVDLVRKRAYMYVQLMLDAVVDYLPAPRADDNEPLAALAFKIMADPY-GRLTFVRVYSGVLKKGSYVLNATKNKK---ERISRLVLMKADDRQDVEELRAGDLGAALGLKDTLTGDTITDEGAPVILESLFIPEPVISVAV---------EPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEILVDRMLREFVEANVGAPQVAYRETIRKPVTNVEGKFIRQSGQYGHVVINLEPGEPGTGFEFVS-----KIVGGVVPKEYIGPAEQGMKESCESGILAGYPLIDVKATLVHGSYHDVDSSEMAFKIAGSMAL-KEAVLKASPVLLEPMMKVYIGNVIGLISRRGQIESQSTEQLAKVASKVPLATMFGYATDIRSKTQGRGIFTMEFSHYEEVPRS---VAETIIAKSKGN....... 691
5 -91.600[J] KOG0469 Elongation factor 2  ali follow..  16  17..RNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFEGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRININVIIATYGDDDGPMGPIMVDPSIGNVGFGSDTMLQMIAFHLPSPVTPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLVGVDQVKGGTITTYKDAHNMRVMKFSVSPVVRVAV---------EAKNPADLPKLVEGLKRLAKSDPMVQCIFE-ESGEHIIAGAGELHLEICLKDLEEDHAPLKKSDPVVSYRETVQSESNQICLSKSPNKHNRLHCTAQPMPDGLADDIEGGTVNARDVTKGVQYLNEIKDSVVAGFQWATREGVLSDENMRGVRNVHDVTLHADAIHRGGGQIIPTARRVFYASVLTAEPRLLEPVYLVAVGGIYGVLNRRRGHVFETGTPMFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDAGTKPNQIVLDTRKRK...... 836
6 -89.100[J] KOG0465 Mitochondrial elongation factor  ali follow..  20  67.CNKLRNIGISAHIDSGKTTFTERVLYYTKRIKAGRDNVGAKMDSMDLEREKGITIQSAATYCSWKNYHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGSDPFRAIEQLNS---KLKIPAAAVQIPIGSESSLSGVVDLINRVAIYNIQPVLDAIVDYLPNPVPAVQQPFVGLAFKL-EEGKYGQLTYVRVYQGRLRKGNYITNVKTGKK---VKVARLVRMHSSEMEDVDEVGSGEICATFGIDCA-SGDTFTDGSVQYSMSSMYVPDAVVSLSITP----------NSKDASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGELHLEIYVERMRREYVDCVTGKPQVSYRESITIPADFDYTHKKQSAGQYGRVIGTLSPVDDIT----KGNIFETAIVGGRIPDKYLAACGKGFEEVCEKGPLIGHRVLDVKMLINDGAIHAVDSNELSFKTATMSAF-RDAFLRAQPVIMEPIMNVFQGNVIGLNKLQAVIQDTENGHEFTLKAECALSTMFGFATSLRASTQGKGEFSLEFSHYAPTAPH---VQKELISEFQKKQAKK... 761
7 -87.600[J] KOG0468 U5 snRNP-specific protein  ali follow..  16  129..PLIRNVALVGHLHHGKTTFVDCLIRQTHPQFEMEERQLRYTDTLFTEQERGCSIKATPVTLVLKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILELKLPPQDAYF---KLKHIVEEVNGLLSTYGAPDDNLLVSPILGNV-CSGFVDMCVEHIKSPLEQYGTLMVHSSKMYPNDDCTFFQVLARIVSGTLHAGQEVRVLGENEDSRILQVGRLWVFESRYKVELNRVPAGNWVLIEGIDQCIVKTSTVPEDLYIFRPLKFNTQSIIKIAV---------EPVNPSELPKMLDGLRKVNKSYPLLSTRVE-ESGEHVILGTGELYLDCVMHDLRKMYIDIKVADPVVAFCETVVETSSLKCFAETPNKKNKITMISEPLEKGLAEDIENGTVCINWNEVDKNLLTAVKDSIVQGFQWGTREGPLCEEPIRNVKFKILDGVIANEALHRGGGQIIPTARRVAYSAFLMAPRLMEPYLFVCVSAVYTVLARRRGHVTQSGSPIYTIKAFIPAIDSFGFETDLRTHTQGQAFCLSVFHHWQIVPGDKTRRRKPMLLELARQDVLINYP 974
8 -78.700[J] COG4108 Peptide chain release factor RF-3  ali follow..  20  12.VSKRRTFAIISHPDAGKTTITEKVLLFGRAIQVRGSNQHAKSDWMEMEKERGISVTTSVMQFPYGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDREIRDPMELMDEVEN---ELKIACSPITWPIGCGKEFKGVYHIHRDETILYVDHMLDGLTQWAPSPSEEKFTGFVFKIQANMDPKHRDRIAFVRIVSGTYKQGMKMNHVRLGKQ---VNISDAVTFMAGDRARAEEAFAGDIIGLHNHGTIQIGDTFTQ-GETLKFTGIPNFAPELFRRI---------RLRDPLKQKQLLKGLVQLS-EEGAVQVFRPLQNNDLIVGAVGVLQFDVVVSRLKSEYNVEAIYEGVNVATAR..................................................................................................................................................................................................................... 474
9 -38.000[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  26  55......NIGTIGHVDHGKTTLTAAITKCLSDLGQASFMDYSQIDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKIVVYINKVDMVEPDIELVEMEMRELLSEYGFDGDNT--PIVSGSALCALEGREPEIGLNSITKLMEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTVVTGRVERGTLKKGAEIEIVGYGSHLKTT-----VTGIEMFKKQLDAAVAGDNCGLIKREQLKRGMIVAQPGTVAPHQKFKASFYILT......................................................................................................................................................................................................................................................................................................... 355
10 -37.600[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  17  25..KSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKLVVAINKMDLVDETFTRIREDYLTFAGQLPGNLDIRFVPL---SALEGDNVASQSESMPWYSPTLLEVLETVEIQRVVDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGVESNVARIVT-------FDGDREEAFAGEAITLVLTDEIDIGDLLLAADEALPAVQSASVDVVQPLSPGQSYDIKIAGKKTRARVDGIRYQVDINNLTQREVENLPLNGIGLVDLTFDEPLVLDRYQQ.......................................................................................................................................................................................................................................... 411
11 -34.700[J] COG0050 GTPases - translation elongation factors  ali follow..  25  14......NVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFMNKCDMVDDELELVEMEVRELLSAYDFPGDDL--PVVRGSALKALEGE--AEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTVKS-TCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIKPHTTFESEVYILS......................................................................................................................................................................................................................................................................................................... 313
12 -34.100[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  21  5..KVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGENGQTREHALLAQTLGVKLIVACNKMDSTEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEAVERKEGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEM-------HHESLPEAVPGDNVGFNSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISN-GYTPVLDCHTAHIACKFNELKEKDRRTGKKVEDFPKFLKSGDAGIVELIP............................................................................................................................................................................................................................................. 406
13 -33.800[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  24  8..KPHLNLITIGHVDHGKSTLVGRLLYEHGEIPAHIIEEYRVMDRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGVMEQTREHAFLARTLGVPMVVAINKMDATSPPYNEVKADAEKLLRSIGFKDISF-VPI---SGYKGDNVTKPSPNMPWYKPTLLQALDAFKVPEKPINKPLRIPVEDVYSITGIGTVPVGRVETGVLKPGDKVIFLPADKQGDVKSIEM-------HHEPLQQAEPGDNIGFIAKNDIKRGDVCGHLDTPPTVVK.................................................................................................................................................................................................................................................................................................................. 321
14 -33.200[J] KOG0458 Elongation factor 1 alpha  ali follow..  17  165..LPHLSFVVLGHVDAGKSTLMGRLLYDLNIVNQSQLRKLQIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNADGQTKEHMLLASSLGIHLIIAMNKMDNVDQRFEEIKSKLLPYLVDIGFFEDNINWPI---SGFSGEGVYKIEYTDEYNGPNLMSTLENAAFKISKEDDPFLF-IIPSKKTSNDLALVSGKLESGSIQPGESLTIYPSEQSCIVDKIQV-QQGQSTNHEETDVAIKGDFVTLKYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLP-GTPFILFIGVKEQPARIKRLISFIDKGNTASKKKIRHLGSKQRAFVEIEL............................................................................................................................................................................................................................................. 571
15 -32.300[J] KOG0459 Polypeptide release factor 3  ali follow..  20  99..KRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQIQKYEIMDTNEEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEGGQTREHVQLAKTLGVSLIVVVNKMDDPTVNYDEIEQKMVPFLKASGYNTKK--LPISGLMGKNMDQRMGQEICPWWSGPSFFEVLDSIEIPPRDPNGPFRMPIIDKFKDM--GTVVMGKVESGSIREGDSLVVMPNKEQVKVVAIYC-------DEDKVKRAGPGENLRVREDEDILSGFVLSSIVNPVPAVTEFVAQLQILELLDNAIFTAGYKAILHIHAVVEECEIIELKSQDLKTRKPMKKKVLFVKNGAAVVCRIQV............................................................................................................................................................................................................................................. 490
16 -30.700[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  18  43......NIGTIGHVAHGKSTVVKAI---SGVHTVRFKNELEQLDDPSCPRPECYRSCGSSMPDEFPVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCQPQTSEHLAAIEIMKLKILILQNKIDLVKERAKEQYEQILAFVQGTVAE----GAPIIPISAQLK----------YNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSEVDDLKGGVAGGSILKGVLKVGQETVSKDSEGKLMCKSIFSKIVSLFAEHNDLQYAAPGGLIGVLCRADRMVGQILGAVGA........................................................................................................................................................................................................................................................................................................................ 363
17 -27.100[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  24  8......NIGLVGHVDHGKTTLTKAL---SGV-----------TDTHSEETKRGISIRLGYADITFRKRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCQPQTKEHLMALDVIGVKVIVVQNKIDIVSKEALESYREIKEFVKGTCAE----DAPIIPVSAQQG----------ANIDILIETIEERIKTPKRDVDKPARMYVARSDPEHLAGGVIGGSLVQGRLRVGDEIEQVKKDGKQTWMSLHSTITGLVAGGEEMEEVGPGGLVGVLTKADSLSGSVAGEPGT........................................................................................................................................................................................................................................................................................................................ 316
18 -26.700[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  19  3.......IVTSGHVDHGKTALLKAL---TGT-----------TAHLPEEKKRGMTIDLGYAYLPLENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRQLQFHEIVVITKADRTNSAIESLIQTIKQDYSFLR------NANYFVTSAETGQGISELRHYLANL------------AELADTQKPFRYAIDRVFSVKGAGTVVTGTAFSGTVKVNDEIY-LSTGQKIRIKAIHA---NTSSEQGIAGQRLALNLNADLDRTPMKRGDWLLQNEPLPPTDRISVQILAVHIYHGASRTTGKLTLLQGKNAAKNDRTLAEIILDSPLFLAFGDSGDTKTLIAG-ARV-LEINSPKRHKR..................................................................................................................................................................................................................................... 351
19 -26.700[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  18  183.......VTIMGHVDHGKTTLLDK-FRKTQVAAVET----------------GITIGAFLVSLP-SGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELLAVCEDYGGDVQAVPVSALTGDNLMALAEATVALA-------------EMLELKADPNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKC---------AKVRLMFDENGKTIDEAYPSMPVGITGWRDLSAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRSILRFLERKEQI------------PLKPKEKRERDSNVLSVIIKGDVDGSVEAILNIIDTYDAS--------------------------HECELELVHFGVGDISANDVNLAETFDGV---IYGFNVNAGNVIQQSAAKKGVKIKLHKIIYRLVEDLQEELSSRLPC---AVEEHPVGEASILATFSVTEGKKKVPVAGCRVQKGQLEKQKKFKLTRNGHVIW--------KGSLTSLKHHKDDISIVKTGMD..... 691
20 -25.100[R] COG5258 GTPase  ali follow..  22  109......TVVALGNVDAGKSTLVGVLT--TGRLDDGKGLARSYASRYKHEVLTGRTSAVSLRLLGFSDKLVLLVDVGGHERYLRTALRGLSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEFQKTVEEVVRILKMPGVSKIPYIIPVFYVSSVTG----------HGLDLLLRFLSLLPRRRRWDYGGEFLMYISDIYLVKGVGVVIGGLVEKGILHVGDRVWLGYSDGKWMQTVVKSI-----FNRTPVESAKAGSFITLDKVEKVEKGMVLSARP......................................................................................................................................................................................................................................................................................................................... 425
21 -21.200[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  18  448.......VTIMGHVDHGKTTLLDRF-RESRVTEGEA----------------GITQHIGAYQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGANPQRVTQELTEHGVFPVAGSEFVEISAKFNQNLDELLDTVLLVA-------------EVQELKADPTVRAIGTVVEARLDQGKGAIATLLVQQGTLHVQDPIVVGNTYG-----RVRTMTNDLGRRIKEAGPSTPIELTGLSDVPQA--GDHFAVFEDEKAARAAGEER-------AKRAQLIKRQNTRRVNLDNLFDTLKEGQTKSVNIIIKADVQGS-----------AEALAASLQK-----------------------------------------------------------EVEGVKVDIVHSAVGAISESDISLAAASNAI---IIGFNVRPTGLAREQAAQEEVDIRLHSIIYKVIEEVETAMRGMLDPVRETFNVSKVGT----AGFMVIRGKVARDASVRVIREGVVIHDGAIASLKHFK----LMVEDFNDVEIDDT------FEVYKMVEIERK.. 944
22 -18.000[E] COG4917 Ethanolamine utilization protein  ali follow..  23  1....MKRIAFVGSVGAGKTTLFNALQ-----------------NYTLARKTQAVEFNDK-----------GDIDTPGHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIG--VSKRQIAVISKTDMPDADVAATRKLLLET.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 118
23 -15.900[R] KOG2486 Predicted GTPase  ali follow..  17  133..DGLPEFALVGRSNVGKSSLLNSLVRRKRLAL--------------TSKKPGKT---QCINHFRINDKWYLVDLPGYQDWNKFTKDYFLNLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKK..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 262
24 -15.800[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  17  53..TKSNTVLLSGLSGSGKTVLFYQL--------RDGSSHQGAVTSMEPNEGT-FVLHNENNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAAS-ASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEK.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 196
25 -15.400[R] COG3596 Predicted GTPase  ali follow..  14  34LTHYEPVIGIMGKTGAGKSSLCNALFAG---------------EVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVIGEAYKMLFVISQSDK......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 159
26 -14.100[R] COG1084 Predicted GTPase  ali follow..  14  160..LDAFTVVIAGFPNVGKSTLLRTLTGAEPEVAD------------------FTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEMVALENIADVIMFIFDASETCGYTLESQYSLYLGFDIPVVTVFNKMDLAEN------VKYLEEYINMVEDPLKVSAFEGRGVS...................................................................................................................................................................................................................................................................................................................................................................................................................................................... 315
27 -14.000[R] COG1160 Predicted GTPases  ali follow..  21  217......KIAIVGRPNVGKSTLTNRILGEDRVV---------------VFDMPGTTRDSIYIPMERDGQQYTLIDTAGKVHLAVETLQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKS.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 349
28 -13.100[R] COG2229 Predicted GTPase  ali follow..  16  1.MRENK-IIFTGPVGVGKTTAIAAI------SDEALVQTDASASDMTLDRKRNTTVAMDYGAIS-EDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGKAPVVVGITKMDIRSQPGIDVYHK.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 139
29 -12.700[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  23  95.......ILLVGQYSTGKTTFIRYLLESDGDEEGSIPGNALVVDAK-LNRFQCSTLPNQVLE------SVTIVDTPGILDFTGVLEWFAERVDRIILLFDAHKDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQ..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 261
30 -12.700[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  13  67IGEVLSRVAFFGRTSSGKSSVINAML--TNCFLSVEGTDGDLHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGTTELDSWIDKFCLDADVFVLVANSESTLNTEKHFFHKVNEWLSKPNIFILNRWDASASEPEYMEDVRRQHMERC...................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 260
31 -12.000[R] KOG0395 Ras-related GTPase  ali follow..  17  17..KNSYRMVVLGASRVGKSSIVSRFLN------------GRFEDQYT-------TIHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDN-LEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSG....................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 162
32 -11.900[R] COG0218 Predicted GTPase  ali follow..  17  23..DELPEIALAGRSNVGKSSFINTMLNRKNLAR--------------TSGKPGKT---QLLNFFNIDDKMRFVDVPGYEKWGCMIEEYLENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADK......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 148
33 -11.700[P] COG0370 Fe2+ transport system protein B  ali follow..  18  1.MSQNT-YCILGNPNTGKTSLFNAL---TGS-------------YEYVGNWSGVTVEKKVGT--LRSKTGKLIDLPGIYDLNPTVVTRFLL-DCMLNIVDSSQ--IERNLNLTVQLLEYGAPVVMGLNMIDV--AAGRGIHLNIQNLAKKLRIPILPVVARSGKGTE...................................................................................................................................................................................................................................................................................................................................................................................................................................................... 151
34 -11.700[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  15  14......KLVLVGDGGTGKTTFVKRHL--TGEFEKKYIAT-------------GVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVNKVDVKE---RKVKAKTITFHRKKNLQYYDISAKSNYNFE...................................................................................................................................................................................................................................................................................................................................................................................................................................................... 160
35 -11.600[T] KOG4252 GTP-binding protein  ali follow..  15  6.MEVAIKMVVVGNGAVGKSSMIQRYCKGI---------------TKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEVGDIPTVNKIDLLDDSC--KNEEAEALAKRLRLRFYRTSVKEDLNVN...................................................................................................................................................................................................................................................................................................................................................................................................................................................... 159
36 -11.500[R] KOG0394 Ras-related GTPase  ali follow..  15  6..RTLLKVIILGDSGVGKTSLMNQYVNKK---------------SNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLINFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVE.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 166
37 -11.300[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  20  16LWQKEAKILFLGLDNAGKTTLLHML------------KDERLVQHQP-------TQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYD-SKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGK................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 155
38 -11.300[R] COG1159 GTPase  ali follow..  18  11.......IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTR-------HRIVGI--------HTEGPYQAIYVDTPGHMEEKRAINRSIGDVELVIFVVEGTRWT-PDDEMVLNKLRDGKAPVILAVNKVDNEKVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPEAIHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVTNERGGYDINGLILVEREGQK........................................................................................................................................................................................................................................................................................................................................................................ 243
39 -11.200[R] KOG1673 Ras GTPases  ali follow..  15  103......KISLLGDCQTGKTTFVVKYVG----------------ENQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGGD--SKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKTAIPILIGTKFDDFVRLPPNLQWTIVTQARAYAKV---MNASLFFSSATHNI.................................................................................................................................................................................................................................................................................................................................................................................................................................................. 253
40 -11.000[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  13  466..DIMGKVIMLGDSGVGKTSLLIRF--RDGRYVPSYFLST------------GIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWREYAQEDVVIVLIGNKADCSGSERQVKREDGERLGREHNVPFMETSAKTGLNLSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNTKARS................................................................................................................................................................................................................................................................................................................................................................................................................... 658
41 -10.800[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  19  18..KEEMELTLVGLQFSGKTTFVNVI--------ASGQFAEDMIP----------TVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAAD-SRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNID.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 171
42 -10.700[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  19  21.........LILGLDNGKTTFLETL---------KKEYSLAFKALEKIQPTVGQNVATIPVD---SKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSD-CSTTLQSVVMDEEIEGVPILMLANKQDRQDR----EVQDIKEVFNKIAEHISARDSRVLPISALTG................................................................................................................................................................................................................................................................................................................................................................................................................................................... 172
43 -10.700[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  18  10......KILIIGESGVGKSSLLLRFTDDT---------------DPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTVKLDNWLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGL.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 137
44 -10.700[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  17  21.........LLLGLDNGKTTLLKQL---------------ASEDISHITPTQGFNIK----SVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSAD-TGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQ.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 167
45 -10.600[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  20  20.........LMLGLDNGKTTILKKF------------NGEDIDTISP-------TLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSAD-CQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREALELDSIRSHHWCIQGCSAVTGENL..................................................................................................................................................................................................................................................................................................................................................................................................................................................... 165
46 -10.600[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  14  164IDPNTRTVLICGYPNVGKSSFMNKVTRADVDVQP-------------------TTKSLFVGHTDYKYLRYQVIDTPGILDRPFEIEMALAHLRAAVLFFSGSCGYTIAQQAALFHSIKSLFPLVIVCNKTDL--MPMENISEEDRKLIEEMKSEAMKTAM............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 319
47 -10.500[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  17  25.........LMLGLDAGKTTILYKL------------KLNQSVVTIP-------TVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSAD-ARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLL.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 171
48 -10.400[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  19  21.........LILGLDGGKTTILYRL------------QVGEVVTTIP-------TIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSAD-SKDELLYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGL..................................................................................................................................................................................................................................................................................................................................................................................................................................................... 166
49 -10.400[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  14  11......KLVFLGDQSVGKTSIITRFMYDK---------------DTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNDVIIVLVGNKTDLVEKRQVSIEE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 136
50 -10.400[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  17  20..DYMFKILIIGNSSVGKTSFLFRYADDS---------------TPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTNAQVLLVGNKCDMEDER..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 143
51 -10.400[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  17  8..DHLFKLLIIGDSGVGKSSLLLRFADNT---------------SENYITTIGVDFKIRTMDINGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVNKCEENERR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 130
52 -10.300[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  18  22.........LILGLDGGKTTILYRL------------QIGEVVTTKP-------TIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTD-ASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGI..................................................................................................................................................................................................................................................................................................................................................................................................................................................... 167
53 -10.300[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  16  21.........LMVGLDAGKTTILYKL------------KLGEIVTTIP-------TIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSND-ARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGL..................................................................................................................................................................................................................................................................................................................................................................................................................................................... 166
54 -10.200[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  13  7..EYQFRLILIGDSTVGKSSLLKFFTDGK---------------AELSDPTVGVDFFARLIEMK-TQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVE.................................................................................................................................................................................................................................................................................................................................................................................................................................................... 165
55 -10.200[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  17  4..AYLFKYIIIGDTGVGKSCLLLQFTDKR---------------QPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWRQHSNSNMVIMLIGNKSDLEARR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 127
56 -10.200[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  16  6..DFLFKFLVIGSAGTGKSCLLHQFIENK---------------KQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWRTLASPNIVVILCGNKKDLDPER..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 129
57 -10.200[DTZ] KOG1547 Septin CDC10 and related P-loop GTPases  ali follow..  14  282......NIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRM-----KLTVIDTPGFGDLQEEINRKKRIPDTRVFIPATGHSLRPLDIEFMKR-LSKVVNIVPVIAKADT-------TLEERVHFKQRITADLLSNGIDVY------------------PQKEFDEDSEDRLVNEKFREMIPF-AVVGSDHEYQVNGKRILGRKTKGTIEVENNIKDITSSIHFEAYRVKRLNEGSSAMANGVEE.................................................................................................................................................................................................................................................................................................................................................. 560
58 -10.200[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  16  9..SYIFKYIIIGDMGVGKSCLLHQFTEKK---------------MADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWRNLTNPNTVIILIGNKADLEAQR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 132
59 -10.200[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  20  7..DFLFKIVLIGNAGVGKTCLVRRFTQGL---------------PPGQGATIGVGFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQKVITVLVGNKIDLAERR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 130
60 -10.200[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  16  8..DYLFKTVLIGDSGVGKSNLLMRFTRNE---------------NIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELRENIVIMLVGNKTDLLHLR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 131
61 -10.200[R] COG1163 Predicted GTPase  ali follow..  16  62.RTGVASVGFVGFPSVGKSTLLSKLTGTESEAAE-------------------TTLVTVPGVIRYKGAKIQMLDLPGIIDRGKQVIAVARTCNLLFIILDVNKPLH-HKQIIEKELEGVGIRLDILIKKKEKGGIS..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 191
62 -10.100[R] KOG1533 Predicted GTPase  ali follow..  18  38.........VIGAPGAGKSTFCAGLTDIFSQTKTEMITVNDVMDRLGLGPNGALCIETLGANCNWLLQKIEIIDCPGQLEYKSEVIRFLEKSG-ALHLADSLYCSDPSKLSTLATMVTMEMPQVNCLSKADLFSED..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 210
63 -10.000[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  11  336.LKSIADLGLIGLPNAGKSTILNKISNAKPKIGH--------WQFTTLSPTIGT------VSLGFGQDVFTVADIPGIIQFLRHIERSNGW----VFVLDLSNKNPLNDLQLLIEEVGTTKNILIVCNKVDIDAEKSFAKYLQVEKFSKSQEWDCVPISA............................................................................................................................................................................................................................................................................................................................................................................................................................................................. 494
64 -10.000[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  22  46.........VVGMAGSGKTSFLHRLVCHTFDSKRDTVKYKEVMKQYNLGPNGGISLNLFATKFDEVVSVIELVDTPGQIEFTWSFASTFPTV--VTYVVDTPRSSSPITLYACSILYKTRLPLVLAFNKTDVADHK..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 219
65 -10.000[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  18  61.KTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAA-------------------TTLTTVPGVIRYKGAKIQLLDLPGIIERGRQVIAVARTCNLILIVLDVLKPLG-HKKIIENELEGFGIPPNIGFKKKDKGGIN..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 190
66 -10.000[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  20  14......KIVLLGEGCVGKSSLVLRFVENK---------------SCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTTAEILIVGNKIDLEEER..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 133
67 -9.930[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  17  7..DYLIKLLLIGDSGVGKSCLLLRFSEDS---------------TPSFITTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQNVYKILIGNKCDCEDQR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 130
68 -9.890[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  16  22......KLVLLGESAVGKSSLVLRFVKGQ---------------HEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRNIVIALSGNKADLANKR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 141
69 -9.810[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  11  1.MKRPLIIGVGGPVGAGKTMLIERLTRYMAAITNDKEDARILLNTSVLPADRIAGVETEEMCDKHPDLQLLFLESGGDNLSATFSP---DLVDFSIYIIDVAQGEKIPRKGGMIKS-------LFIINKVDLAPY-VGANVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWI.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 195
70 -9.750[K] KOG1534 Putative transcription factor FET5  ali follow..  15  8.........VCGVASSGKSTFCGALMSYMKSVGRDLISIDDVMEELDYGPNGGLCFEFLMENLDWLNEEIGIFDMPGQIELIRHLQVTLNFRPCAVYLLESQFLVDRTKLSAMSAMVMMEVPHINLLSKMD.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 176
71 -9.750[J] KOG1191 Mitochondrial GTPase  ali follow..  17  349LLQSGLQIAIVGRPNVGKSSLLNAWSKSERAI---------------VTEVAGTTRDVVEANVTVRGVPITLLDTAGIRETNDIVEKAAKVADVIIMAVSAVEGWTEEDTELLRKIQSDKQPMILVMNKIDCAPPG---SCDQLEDQRKKEEVFHKSVFTSAVTGQGIEELEDAI.............................................................................................................................................................................................................................................................................................................................................................................................................................................. 529
72 -9.740[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  14  7..DYLIKFLALGDSGVGKTSVLYQYTDGK---------------NSKFITTVGIDFREKRVVYR-QRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQR..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 141
73 -9.720[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  14  6..DYLFKLLLIGDSGVGKSCLLLRFADDS---------------LDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRNVNKLLVGNKCDLTSQK..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 129
74 -9.540[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  22  59.KYGHGRVALIGFPSVGKSTLLTMLTGTHSEAAS-------------------TTLTCIPGVIHYNDTKIQLLDLPGIIERGRQVIAVAKSSDLVLMVLDASK-SEGHRQILTKELEAVGLPPQIYFKKKKTGGIS..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 188
75 -9.270[R] COG0523 Putative GTPases (G3E family)  ali follow..  15  1.MTPIAVTLLTGFLGAGKTTLLRHILNEQHGFK--NEFGEVSVDDQLIGDTQIKTLTNGCICCTRSNELEDVIECTGMADFSHDVLCERYLLDGVIALVDAVHA-NEQMNQFTIAQSQIGYADRILLTKTDVDSEKLRERLARINARAPVYTVVHGDIDLSQLFNTS...................................................................................................................................................................................................................................................................................................................................................................................................................................................... 199

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.