current user: public

If you have questions about the server, please let us know.

Query: [R] COG1235 Metal-dependent hydrolases of the beta-lactamase superfamily I, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290
# Score Template Links and tools%idFirst MLLGCAMAFDSDTRSRESNRNFRVKIWGARGTLPVSGENFRKYGGNTICIEVRCGDHVLLFDAGSGLHPAGLALRAEGITDVNLFFSHCHYDHIVGFPYFKPFYNSSNDVAIWSGHLAGSMTTREMLKDFMSPPWFPVPLEICCAKIATRDFKAGDVLDVHPGLSIRTGMLNHPGNAIGYRLDWEGKSLAIITDTEHEPSSIDETVLDLIRDVDLFLYDAMFTDEEMGLYRGYGHSSWQQAIRLAKLADAKNVGFIHHAPSRSDEELDDIEKQAKAEFNGAFAAMDGQVIEILast
1 -109.000[R] COG1235 Metal-dependent hydrolases of the beta-lactamase superfamily I  ali  100  1MLLGCAMAFDSDTRSRESNRNFRVKIWGARGTLPVSGENFRKYGGNTICIEVRCGDHVLLFDAGSGLHPAGLALRAEGITDVNLFFSHCHYDHIVGFPYFKPFYNSSNDVAIWSGHLAGSMTTREMLKDFMSPPWFPVPLEICCAKIATRDFKAGDVLDVHPGLSIRTGMLNHPGNAIGYRLDWEGKSLAIITDTEHEPSSIDETVLDLIRDVDLFLYDAMFTDEEMGLYRGYGHSSWQQAIRLAKLADAKNVGFIHHAPSRSDEELDDIEKQAKAEFNGAFAAMDGQVIEI 292
2 -55.700[T] COG5212 Low-affinity cAMP phosphodiesterase  ali follow..  14  4ALEIKEAEFQTDQVVGLVENSFTLYSLGQNGGP---------LESCCSSHLISDGQEIISLDGGSHLSALVELIQSKEQRIKTFLITHCHLDHIYGAVINSAMFGPQNPRTIVGL----NYVIDTLKKHVFNNLLWPSLDKA--GFINFQVVEPSMYTSLTTTLSILPFPVNHGSSAFLFRNNLSDRYFLAFGDVEPDMVASEPLNIHIQRKLSHILIECSTPDIP--DTLLFGHFCPRHLVNYGVIMPTLTCLLTHLKSHPLQSPADVILEQLESLSSTFKILQRGQFYKF 346
3 -54.300[R] COG1234 Metal-dependent hydrolases of the beta-lactamase superfamily III  ali follow..  19  1.....................MDIQFLGTGAGQPSKAR-------NVSSLALKLINEVWLFDCGEGTQNRILETTIRPRKVSKIFITHLHGDHIFGLPGFLSSRAEQTDLEIYGPQ-----GIKSFVLTSLRVSGSRLPYRIHFHEFD----DSLGKILETDKFTVYAEELDHTIFCVGYRVMQPGKIITILGDTR-----KTGASVRLAVNADVLVHESTYGKGDEKIARNHGHSTNMQAAQVAVEAGAKRLLLNHISARFLSKDISKLKKDAATIFENVHVVKDLEEVEI 309
4 -41.300[R] COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  13  26.PGSNPGRGTTRILTTFKAINMKVIPLASE-----------SLGVRSLALFLKIGKVGILIDPGVALGPKREKIQEYAKKAQIVTISHYHYDHHTPFFEGIYESSVEKAREIYAGKLLLIKHPTENINNSQKKRAHEF-LKNAKEIAKDIKFADSQSFDFGSFTIEFSPPVPHLGYVLMVLVDDGKKSVLHASDTQLINDKAVEWIIE--KNPDILIAGGPPTYLA-HRVGNVKEIGMKNINRIISETNAKIVLDHHIIRD------KGYERFFSELDERPLTFAEFLGKES 319
5 -35.200[R] KOG2121 Predicted metal-dependent hydrolase (beta-lactamase superfamily)  ali follow..  14  467...SECNTVLPNCLEKIRRDDMEIVILGTGSSQPSKYR-------NVSAIFIDLSRGSLLLDCGEGTLGQLDGADEAVRKLRCIWISHIHADHHTGLARILALRSTHEPVIVVGPRPLASLESGGEAEGSLFTQGSPMQSVFKRSDISMDNSSVLLCLKNLKKVDLISFPVVHCPQAYGVVIKALGWKMVYSGDSR-----PCPETVEASRDATILIHEATFEDALIEEALAKNHSTTKEAIDVGSAANVYRIVLTHFSQRYP-----KIPVIDESHMHNTCIAFDLMSINM 797
6 -22.000[A] KOG1137 mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit)  ali follow..  12  1MASSSTSLKRREQPISRDGDQLIVTPLGAGSEV------------GRSCVYMSFRGKNILFDCGSGMAALPYFDEIDPSSIDVLLITHFHIDHAASLPYFLEKTTFNGRVFMTHATKA--TDYVKVSKVSVEDMLF--DEQDINKSMDKIEVIDFHQTVEVNGIKFWCYTAGHVLGAAMFMVDIAGVRILYTGDYSREEDRHLRAAELPQFSPDICIIESTSGVQLHQSRHIREKRFTDVIHSTVAQGG--RVLIPAFALGRAQELLLILDEYWANIYYASPLAKKCMAV.. 291
7 -21.900[A] KOG1136 Predicted cleavage and polyadenylation specificity factor (CPSF subunit)  ali follow..  11  2...................PDIKITPLGAGQDV------------GRSCLLLSMGGKNIMLDCGM--FSYIVPEGPITSHIDCVIISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGG--KVLI----PVFALGRAQELCILLETYWER............ 258
8 -19.900[R] COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain  ali follow..  13  173................IDEKWVRVTFLGGSREV------------GRSCYLLQTPESRILIDCGVSNLSSTPPEVQPLDALDAVVITHAHLDHCGLVPLLYKFGYRGPIYLTPPTRDLMVLLQLDFLEVAGREGTNPPSNLIREALKHTITLDYGVVTDISPDVRLTFYNAGHILGSAHFHIGEGHYNIAFTGDFKFEKTRLFDRAATNFPRLEALVMEATYPNDFQPSRKEAEERLIEVINRTLDRGG--KVLIPTFAVGRSQEVMIVLEEAMRERLRETYVYLDGMIYEA 447
9 -18.800[R] KOG3798 Predicted Zn-dependent hydrolase (beta-lactamase superfamily)  ali follow..  12  65..DSTLPVHNITADDFHSESGLFATWLG-------------------ATVLVDLEGVKFVTDAGPKRYRPPPMKLEDLPDLDFAVVSHDHYDHL-DADAVKRITNLNPQIKWFVPLGLKKWMKNQGIGADGSNTVTELN-------------ESSEFVKNGKTITIWCLPAQHSGQ--GWAVIGENRRFYFPGDTGFCDVEF-KKIGEKLGPFDLAIPIGAYEPRWFMKSH---HINPDEAVEVHKLVRARNSIGIHWGTEYYLEPRDKLKELMDAR-TSFVTVDMGEIWEA 353
10 -18.500[A] KOG1135 mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit)  ali follow..  11  1.................MTSIIKLKVFSGAKDE------------GPLCYLLQVDGDYILLDCG---LQYFEELKPFIPKISAVLISHPDPLHLGGLPYLVSKCGLTAPVYATVPYKMGQMFIYDMVYSHLDVEEFEHDVDTAFEKVEQVKYNQTVVLKGDSGVHFTALPAGHMLGGSIWRIRVTGEDIVYCVDFNHKKERLNGCSFDNFNRPHLLITGAHHISLPQMRRKDRDEQLVTKILRTVRQKG--DCMI----VIDTAGRVLELAHLLDQLWSNADAGLSTYNLVM 267
11 -18.000[J] COG1236 Predicted exonuclease of the beta-lactamase fold involved in RNA processing  ali follow..  2..............................................LSVISSEIGVSKKLIDLGRTFSIDTTRSPGKQPQPDAYLITHAHSDHHGKSAMLS--------------------------RAVCTDKTATALEIRHDRKYVGSMCRLGDEIEI-EGVRVKTYPTAHTAGAAAFYWENVGTRILVTGDVKNASK---------LPPCDVLITEANYGDPEDPSC-----HFADDLESMKCALFESGPVAF---GAYEFGKAQRAVELMRGFGYEGAIRMEARTRAL 234
12 -17.100[R] COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II  ali follow..  13  1................MGRMVVKVTIV-FENHAGYRKGLIGYHG----SALVESNGYKVLVDTGTDLLNNMHELGIDANDIDVLFITHGHYDHTGGLKEFLKERSEPIEV-YAHPGIFDERIALKPRKRDIGIPFQRKELEELGARFNLSP----EPLEFLPGFISSG-----KRVTWDRAVGYFPDGRKDPVRDDMALIVEGSKGLVVISGCNIARHAMELRGSKIAALIGGFHLLLDDVVTNMKELGVNALYPGH----------IEEFSYLWSKLDNVEGIYVGKEIKI 272
13 -16.800[R] COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold  ali follow..  14  85...VSPIPVYVIDWNKINSENDSLTWFG-------------------SAFLLNVDNKQLLID--VGRNRYEYS-IDEMPPIDAVLITHDHYDHL-------------------------DYRSIVKLNNKVSHFFVPLGCSAHLIRWGIPEEKITEEETEYQGLTVALTPSRHSSG--GWVILGNKTRVYTSGDSGYGPH---KQIGDKYGPFDITLIEG----AQYDRNWPDLHMVPEQAIQANLDVGGKTMMLMHWANHAWNEPIERALKEAKIREVNIIAPMIGETVLL 359
14 -15.300[L] KOG1361 Predicted hydrolase involved in interstrand cross-link repair  ali follow..  12  151.....................................................LPGTPFTVDA------------GCVQGCSAYFLTHFHADHYIGL--------------------TKAWSHGPIYCSSLTSRLLRLSLSVNPSSIHPLELDVEYTI---NGIKVTLIEANHCPGAALIHFRLDGTCYLHTGDFRASKQMQTHPLLFNQR-VHVLYLDTTYCNPRYK------EDVLSYVVRITKDKQPKTLIVVGSYSIGKECVYLAIAKALGVKI.............. 344
15 -15.300[R] COG0595 Predicted hydrolase of the metallo-beta-lactamase superfamily  ali follow..  14  2...................SNIKITPLGGVREF----------GKN--MYLVEVEEQIFVLDAGLGVDFVITYLLENADRVAGIFLTHGHADSIGALPYIV----SELKVPVFGSELTIELAKINVKNYADSRKFNDFHVVTEDTEIDF------------GKAVISFFSTTHTPESLGIVISTNDGNIVYTGDFRFDPAVAKGYRTNMRRGVLALLSSSPQSASEHEIYEKIYDYIDDNEGRVIIACNAGNLGRIQQTIDAAIKLGRRVAFTGEDMDQIIETATRLNKLQI 271
16 -15.300[R] COG0491 Zn-dependent hydrolases, including glyoxylases  ali follow..  12  12.............................................KTNCYVVRGENEVAIIDPGHAHDDLVEYITTNNLSVDKIVLTHGHIDHTRDAGVVAKRF----NAPVYIHPDDAFFLEVYKGSGTKTAMLFDADNMVSPDPESLRDLVDGETITLAGEEFTLKHAPGHSPGCTLIVGKE-GRTDFEWSDADAMNESLRTAVLPLDDALQIL-----------------GHGPTTTMRA................................................. 202
17 -15.000[R] KOG0813 Glyoxylase  ali follow..  11  19................................GCNPSAMTLQ---GTNTYLLGSGSRRILIDTGDEIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSIVGTKLAEKDCRVFKFGRTDAPDVCP----------------EIPTDIKLHPLAHNQEFTTEGANVRVVHTPGHTTDHVVLAMNEG---TLFSGDCILGEGTAVEDLFEYMKSLEKIL-------DIKPQRIFPGH------GNVIEEPIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKV...... 243
18 -14.000[S] KOG4736 Uncharacterized conserved protein  ali follow..  10  256.KVNSWAKLWTSTAEPKSYVNVTVLQAGSVRPLRD-----GQVEAVGAITLVNDNGYIVLIDTGASLLHSLAKESVTLDQIDSVVITHASPGHMGNMNFFA------------------------------QKPILYHSMEYIGRHVTPTELKERPYRKLSGNVEVWKTP-GHTQHDLSVLVHNVAGTMAIVGDLVWDNAIKRQNANLIVCMADWIV----------------GHQPFRVLPNYRQKAGCTRLLAQRHLLNQAFLSFFRLHGDVLSF............... 506
19 -13.600[R] COG2333 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  12  62SFGIILLCFTILLFKQLSKPTWQVDTLDV---------------GQGLATLIVKNGKGILYDTGSAELEILPYLQREGIVLEKLILSHDDNDHAGGASTILKAYPNVELITPSRKNYGENYRTFCTAGRDWH------------QGLHFQILSPHNVVTRADN-----------SHSCVILVDDGKNSVLLTGDAE---AKNEQIFARTLGKIDVLQV---------------GHSKTSTSEYLLSQVRPDVAIISSGRWNPWKFPHYSVMERLHRYKSAVENTAVSGQVRV 307
20 -12.800[A] KOG1138 Predicted cleavage and polyadenylation specificity factor (CPSF subunit)  ali follow..  3....................DCGLTEQTVLNFLPLPFVQSLKWSNLPPSRDHDPQMDGELKDCCGRVFNLPMDKMLDFSEVDVILISN-YLNML-ALPYITENTGFKGKVYATEPTLQIGRFFLEELVDYIEVS---FSLKDVQGSLSVTIMGYDEKLDILGAFIATPVSSGYCLGSSNWVLSTAHEKICYVSGSSTLTTHPRPINQSALKHADVLIMTGLTQAPTVNPDTKLGELCMNVALTIRNNGSA--LI-----PCYPSGVVYDLFECLTQNLENAGLNN....... 298
21 -10.800[R] KOG0814 Glyoxylase  ali follow..  13  22..YLSSFGTMSLPERQPFSPDFFFRQL------------DGESSTYSYLLADLKNGQAVIIDPVLEQAKRDAQLVKDLGELKYAINTHMHADHITGSGWLRKLTG-------------------------------QSVIAAASGAKADRHLNEGDRIDF-GTHVIDALATGHTNGCMTYVIKDQG--CVFTGDT-------------------LLIRGCGRTDFQEGCPRNLYENVHSKIFTLPENF---RIYPAHDYKGQMESSVWE....................... 224
22 -10.000[Q] COG2015 Alkyl sulfatase and related hydrolases  ali follow..  127............................................DLANITFVKGDTGWIVFDPLTVPATAKAALDFGERPVKAVVYSHAHADHFGGVKGIVS--VDRGEVPIIAPKGFLNHAVAENAMSRRTTYQYGNVLPKGATGQVDAAIGKNVAQGEVSLIAPTKVISEQ-----TETVVIDGVTMEFQ---NTPGTESPAEMNTYFPQFKALWMAENTVGAEVRDAKAWSKY---NESIHMYAKEADVMFASHTWPRWGNDNINHFLRKQRDMYGYI........... 374
23 -9.000[C] COG0426 Uncharacterized flavoproteins  ali follow..  12  1.MVSMSTTGNAHTENVQHRLTVETTAIRCL-DRDRFDIEFGLQNGTTYNSYLIRGEQTVLVDTSHQYLETLKGL-INPKAIDYIIVSHTEPDHSGLVEDVLQLAPRATVL--------ASKIALQFLEGLVHDPF------------SKRIVKSGDRIDIGKGHEIEFVSAPNLHWPDTIFSYDRKTEVIYTCDA----GMHFCDNRTFDEDLEAIEADFRFY---YDCLMGPNARSLLNAMKRMGDLGKIKIIANGHGPLLYHHLDVLTECYQS................. 260

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.