current user: public

If you have questions about the server, please let us know.

Query: [K] COG1321 Mn-dependent transcriptional regulator, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220
# Score Template Links and tools%idFirst MVLMHTDRIEEYLETILYLITKNQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPYQGVELTEKGAEEAVRIKRKHQVLETFLADVLDFDRKEAHREACELEHAVSDSVLERLYDFLGNPEYCPDGHPINIDKCNLQREEKFIPLDEMKEGSSGTVARVTLPRETKERLTSLGILTGEDIEVRRKQKQGCISVMAVGSEIALGRDIAKKIFITPKGKVALast
1 -99.000[K] COG1321 Mn-dependent transcriptional regulator  ali  100  1MVLMHTDRIEEYLETILYLITKNQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPYQGVELTEKGAEEAVRIKRKHQVLETFLADVLDFDRKEAHREACELEHAVSDSVLERLYDFLGNPEYCPDGHPINIDKCNLQREEKFIPLDEMKEGSSGTVARVTLPRETKERLTSLGILTGEDIEVRRKQKQGCISVMAVGSEIALGRDIAKKIFITPKGKVA 224
2 -16.100[K] COG1846 Transcriptional regulators  ali follow..  20  40....LTPSEIHTIDAI-----GTDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVVLTDKGREAYRAHADMHAAFYEELQQSFTKE-----------EIAIFEQCVSKLRDILSE.................................................................................................... 149
3 -15.600[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  12  20............RKVLFYLLSIYPYRSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKNFKINPEIVEEVRNMKNMFSDKKVYTVEI..................................................................................................................................... 112
4 -15.100[P] COG1918 Fe2+ transport system protein A  ali follow..  16  2.......................................................................................................................................................QFTPDTAWKITGFAREPAYRQKLLSLGMLPGSSFNVVRVAPLGPIHIETRRVSLVLRKKDLALIEVEAVSC.. 75
5 -15.100[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  20  87..............LILHSIRHRDREKKLADICLALDIETHIATYAIRKLEKAGLLTTGKAA-VKITAKGAEACAHYAQIRERLLVDSTANARPSEETLSELAALLRFMSG................................................................................................................. 187
6 -13.600[K] COG3432 Predicted transcriptional regulator  ali follow..  13  26.SMQLERRKRGTMEIMFDILRNCEPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDYEITEKGKLLRTHIEEFIKIRENL......................................................................................................................................... 114
7 -13.400[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  19  1....MKMKTLFLLIKLAKMGAGKEITVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRKVELTEKGINLLEKLYEEIS.............................................................................................................................................. 82
8 -12.800[K] COG3355 Predicted transcriptional regulator  ali follow..  15  25....LSKSDVEVLHILLQ-----NGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKEERKGRPNYIYWVEKERLYR------------KLEADLEKLAGTVKEALQKHTALEI...................................................................................................... 125
9 -11.500[K] COG1802 Transcriptional regulators  ali follow..  18  11..ETLRYQVENVLRAIMSGRFTPGERLIERELCETLGVSRTSIREALRRLEAEKLVSIVPHKGPIVAIISRQEAAELFALRGLLEGFAAREFAQRATD--VAIVHFAQAIQA................................................................................................................ 119
10 -11.400[S] COG2469 Uncharacterized conserved protein  ali follow..  18  197....LSEVEEQILTMVYT--------VDSVSVESILGVTTEELNKMYDRLVNLGLARVVKIKEIELTPRGVALVSEIMKK................................................................................................................................................ 266
11 -11.400[S] COG4754 Uncharacterized conserved protein  ali follow..  17  10.......RIADLVGLLYVMNNIFDGKTDLYQLEKEMEVDIDDLMPIVYTASRLGFVSAES-GDIIVTEEGKEYIREALRNIEPFRTALDLRNFDCETLMENLQRKVQTFNSPSGKHDLEVIL...................................................................................................... 135
12 -10.800[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  15  26...............IYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRE-----LVQSGWLGYIYTPVSPLEILQK-IKEHLMKSIEELERDLKNQTRS................................................................................................................... 113
13 -10.700[K] COG1497 Predicted transcriptional regulator  ali follow..  24  1.MKALRKKGELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVESGSGRSYKITRRGAEKIKEAAMDLRRYADEVLESM.................................................................................................................................... 92
14 -10.600[K] COG4742 Predicted transcriptional regulator  ali follow..  22  12.....SQKRRDLLLLL------GEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKN-GSYELTDMGEQVFKKARALVDVLTLV......................................................................................................................................... 86
15 -10.400[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  15  4YEKEIDELINDYDMLRVLKHFTIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNTSIKRTEAKLKKSAEVHKHHTYYQ........................................................................................................................................... 88
16 -10.100[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  19  251.............CEVLDIIRGHKGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLR--------NGRENILVLVDEEH.............................................................................................................................................. 311
17 -10.000[K] COG1510 Predicted transcriptional regulators  ali follow..  11  6.LDIIEHAEEHLIEKVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVR-QDYYQTFISLFAANWTKVVSKNKVLYKKLNRELSDLLQRDG--LTPEAEEKVNQLLNE.................................................................................................... 148
18 -9.920[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  12  1..MELSPVFARRLYLALLVESLER--PNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDGYQLSDWGPFDSQWVTERKK-----IAASLGFC................................................................................................................................. 94
19 -9.910[K] COG1725 Predicted transcriptional regulators  ali follow..  16  1MNPTFHADKPIYSQISDWMKKQEDKLPSVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGMGSFVTSDKALFDQLKKELDAITERFLEEAIGLDDQTAIE........................................................................................................................... 112
20 -9.760[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  12  13.DMDTLKRHISVINVL-----LREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPS-REGAILTPDFIEHKEQIIAD................................................................................................................................................ 85
21 -9.680[K] COG4190 Predicted transcriptional regulator  ali follow..  21  63LMDTLTPRVLELIEAI-----RQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEE.................................................................................................................................................................... 117
22 -9.080[K] COG1959 Predicted transcriptional regulator  ali follow..  15  1..MQLTSFTDYGLRALIYMALPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVKNGGIRLGKPASAIRIDVVR................................................................................................................................................. 81
23 -9.070[K] COG2345 Predicted transcriptional regulator  ali follow..  19  10AHTGDGDTRRKILLIL-----LERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPR.................................................................................................................................................................. 66

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24