current user: public

If you have questions about the server, please let us know.

Query: [R] COG1427 Predicted periplasmic solute-binding protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MTITVGEIKYTNAFPFFYYVDRNKLLEKDCHFLIQTPATLNREMKAGRIQVGPISSFAYAENVDEFVLMPNLSVSANGPVGSIFLYTKRPLEELEGSRIALTTTSATSVHLLKILLKQYVGVNVTYDEMDPSFDEMMQDHDGCLLIGDEAIVTSWREEVETYRYDLGELWKEYTGTSMTFAVFAVRKDAIARQRAILEELYTAFVLSKEKNRKEQYASMIGHIQKGMGGTTAFWNHYFSNLVYDFHTQQQKGLLLFYEKAYEEGFLPKPIESIKIWGDVRTHHSSLMLast
1 -110.000[R] COG1427 Predicted periplasmic solute-binding protein  ali  100  1MTITVGEIKYTNAFPFFYYVDRNKLLEKDCHFLIQTPATLNREMKAGRIQVGPISSFAYAENVDEFVLMPNLSVSANGPVGSIFLYTKRPLEELEGSRIALTTTSATSVHLLKILLKQYVGVNVTYDEMDPSFDEMMQDHDGCLLIGDEAIVTSWREEVETYRYDLGELWKEYTGTSMTFAVFAVRKDAIARQRAILEELYTAFVLSKEKNRKEQYASMIGHIQKGMGGTTAFWNHYFSNLVYDFHTQQQKGLLLFYEKAYEEGFLPKPIESIKIWGDVRTHHSSLM 287
2 -89.800[R] COG2107 Predicted periplasmic solute-binding protein  ali follow..  19  1MKIRVAHTPDADDAFMFYAMTHGKVDTWEIEHVIEDIETLNRKAFNAEYEVTAISAHAYALLDDKYRILSAGASVGDGYGPVVVAKSEIS---LDGKRIAVPGRYTTANLLLKLAVEDFEPVEMPFDRIIQAV--LDEEVDAGLLIHEGQITY--ADYGLKCVLDLWDWWSEQVKLPLPLGLNAIRRDLSVEVQEEFLRAMRESIAFAIENPDEAIEYAMKYSRGDRERAKRFAMMYVNDYTYNMPESVDAALKKLYEMAEAKGLIKM--PKLDILR.......... 270
3 -18.700[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  16  23VNVTVAYQT--SAEPAKVAQADNTFAKEGATVKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGNSEALVVKKSKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGVNLQPPAIIAAWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQW--------PTLDVWVVRKDFAEKHPEVVKAFSKSAIDAQQPYIANPDVWLISKLARLSGVPEGDVPGLVKGNTYELTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSR....... 317
4 -17.800[K] COG3888 Predicted transcriptional regulator  ali follow..  11  73.LLRIGCLRSTEYVKFV-SVAKNYSESKGIDLFYDDAISLMNDLSQGLLEFALATEIIYSISNRNSIILGAVASGGSG----------YKNVNCNCGKILTSESSSMMILAREFAKTRKISEIAIFKDPRRAIKDYESFKAEYIVIWEPYASKIMGEKMASFSDVLDS---------FPCCGISVSENN--RENRTLIEIVRLYKRSRFTAREDVIDIFAKSTSVSPKTAKASLENY--IWDIKFYRSDLKKYLEFIGYPPIEEIIEKIYEEV.............. 327
5 -14.500[P] COG0715 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components  ali follow..  12  62.TVKLGYIPIVESAPLIIAKEKGFFAKYGLTSKQASWGSARDNVEIGSAGGGIEGLITKGNQKIPMYVLCQLITHGNGIAASAKSLFSKLKASPTPFTAAQTFPAVNQDFWIRYWLAAG-DVKLLTVPSAQTVANMKTGTMDAFSTGDPWPFRIVKDKVGFMAALTAEIWKN-----HPEEYLAMRSDWVDQHPKATKALLKGLMEACDNFDNRKELAEIVAARAYFNVPVDVLILYWKDEKGSVSYPYKSHDLWFITESVRWGFLPKDYIDNNAAKARALIDK... 401
6 -12.000[P] COG3221 ABC-type phosphate/phosphonate transport system, periplasmic component  ali follow..  11  34.EVTFSILSTESTQPILKDMEKQTGLKVKPFFSSNY-SSLIVAMGAKQTDLGWFSNQSGLEAVRRSVFARTFDPSGTDGYKSVIIVPAQSVQDLKSLDFGIGDKKSTSGTLAMTYVFIPANKKPETCFKANLFAVANGKLDASTN--NSTAIGLSKARGEGVTDKIRVIWES----TLPEDPLVWRKDIDPVVKEKLRQFFLTYAQGDTPEAEQQRGYLKRLSIGGFKPADDTHLLVVREMEATEQLGLAR.................................... 304
7 -7.420[P] COG1464 ABC-type metal ion transport system, periplasmic component/surface antigen  ali follow..  15  38.KVKIGVMAGAEAQ-VAEVAAKVAKEKYNLDVTFTDYVTPNAALDDGSIDANAFQHKPYLDKQIA-----KLAIVGNTFVYPIAGYSKQSVDELDGARIAVPNDPTNLGRSLLLLLREDVGLLATVRDIVENLPRSLDDVALSIINTTYASSINLTPEKDGIFVE--------KESPYVNILVAREANVNAENVQNFKKAYQT.................................................................................... 256
8 -7.420[E] COG0040 ATP phosphoribosyltransferase  ali follow..  12  42.......................DVPEENLRFILAKPMDVTTYVEHGVADVGIAGKDVMLEEERDVYEVLDLNI---SKCHLAVAGLPNTDWSGVAPRIATKYPNVASSYFRE-------GEQVEIIKLNGSIELAPLIGLADRIVDIVSTGQTLKENGLVETEHICDI-----------SRFIVNPVSYRMKDDVIDEMASRLSLVVEGETAK......................................................................... 213
9 -7.270[ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain  ali follow..  13  27.NIRIGTDP--TYAPFESKNSQGELVGFDIDLAKELCKRINPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKED--NELREALNKAFAEMRA................................................................................. 241
10 -5.700[S] COG4050 Uncharacterized protein conserved in archaea  ali follow..  2................................................................KIAIFPPNSLILADLVEEPLVIQKEIKKKVTDPEIDSPPFNITEEDPIRGLKYAAIEVPSGVRGRMSIFGPLIEEADAAIIMEEAPFGF----IGCARTNELCVFQLRKRGIPTLELKYPRTREETIDVVNKINNFLDELEAQ................................................................................ 146

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.