current user: public

If you have questions about the server, please let us know.

Query: [F] COG1428 Deoxynucleoside kinases, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MEGVGNKVIVLAGMIGAGKSSYTELIANELGTKAFYESIKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLLDNMMEELAYMPKKAPDLLIYLRGSLDTVLSRISLRGRPYEQTFDNPGLLDYYKHLHSRYDSWFESYDKSDTLVINIDEVDINKPSDAKYVMQLIHEKLKRLast
1 -97.400[F] COG1428 Deoxynucleoside kinases  ali  100  1MEGVGNKVIVLAGMIGAGKSSYTELIANELGTKAFYESIKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLLDNMMEELAYMPKKAPDLLIYLRGSLDTVLSRISLRGRPYEQTFDNPGLLDYYKHLHSRYDSWFESYDKSDTLVINIDEVDINKPSDAKYVMQLIHEKLKR 214
2 -56.600[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  25  78.FDENSKVICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDLIYVRNFCLDPSDLAAQFQIRMYMLRYSQYIDALQHQGVVLERSPYSDFVFMEAMFRQGYLSRGARSVYNELRQNTIGEL-----LKPHLVIYLDLPVDAVKKQIKARNVDYEVQS-KVFSDAYLSDLEQLYKQQYLKDISAELLIYDWTA-----GGETEVVVEDIERIDFN 310
3 -31.800[F] COG0125 Thymidylate kinase  ali follow..  13  1...MSGLFITFEGPEGAGKTTVLQEIKNILGLQVMATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSPLAYQGYARGLGIDEVLSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSR-EKNRLDLEKLDFHTKVQEGYQE-LMKRFPERFHSVDAGQ---SKDLVVQDVLKVIDEALKK 209
4 -23.400[F] COG2019 Archaeal adenylate kinase  ali follow..  11  1......MRSVITGVAGVGKTTVLDIVARESGIPVV----NYGTLMFEVAKRRG----------LVENRDQIRKLSRETQVDLQKLAGE-----EIGKMENAIVDTHMSIKTPFGYLPGLPEWVLRSINASVFVIIEADPAIIKRRRDNDPTR-ARDDEGVDSIREHQEMNRYFAAAYSIFSGATVKIVKNEE------GKPEQAADEIVRVIK. 181
5 -22.400[G] COG2074 2-phosphoglycerate kinase  ali follow..  13  86RQCKEPLIILIGGASGVGTSSIAFEVANRLGIRNMISTDMIREVMRKIVSRELLPSIYESSYTAYQSLRIPPPPELDEVLIGFRDHVEEAVIERALTEGISIVIEGVHIVPGFIREDLVNKENV------MFVLTVSDENVHKGRFYSRCRQMWARRPLKRYISYFWAIRRIHRYIENQARKHGVPVIENIDVVTTIDSIIKSLTKTTVKGGEK 300
6 -21.700[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  13  1MLLPN---ILLTGTPGVGKTTLGKELASKSGLKYI-DLAREEQLYDGYDEEYDCPILDED-----RVVDELDNQMREGGVIVDYHGCD----------------------------------FFPERWFHIVFVLRTDTNVLYERLETRGYN-EKKLTDNIQCEIFQVLYEEATASYKE------IVHQLPSNKPEEENNVDQILKWIEQWIKD 169
7 -21.400[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  15  3........IAITGTPGVGKTTVAKLLAKKLNYEYV--------------------DFALEKGCGRRVNDEVEVEIDELAYFIERELKGKNAVLDGHLSH---------------------------MPVDLVVVLRAHPKLIGERLRERGYDREK-IGENVEAELVDAVLIEAIEEHEN-----VIEVDTTN------KSPEDVVEEIVSLINS 153
8 -21.100[F] COG0572 Uridine kinase  ali follow..  13  4.KAHQCVIIGIAGASASGKSLIASTLYRELREQVGDQHIG----EDGYYKDQSHLSMAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRK-------ETVHLEPKKVIILEGILLLTDIRLRQEM----NFSIFVDTPLDICLMRRMKRDVNERGRSMDSVMAQYQKTVRPMFLQFIEPSKQYADIIVPRGG---KNRIAIDILKAKISQFFE. 213
9 -20.400[R] COG0645 Predicted kinase  ali follow..  12  3.......LAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKR-LFGEQPEHDRGQFAAGIYSSQASEATYAHLHQLAAKILQAG-------YPVVIDAAYLKQNQRQAACHIAEETGVPF---------LILDCQAPEAVIAGWLAQRQAEGKD--PSDATLDVIRTQQATREP-LTAAETVQSKRVDTHD-----AASLDGLVDGIRQRLP. 183
10 -20.000[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  11  1.MTRKTIIVGVSGASCSGKSTLCQLLHAIFEGSSLVHE-------DDFYKTDAEIPVSLNLDAFLENLHYIRDNRENKNVAPEALIEYADIIKEFKAPAIPTLEQHLVFVDGFMMYVNEDLINA-----DIRLMLVTDFDTLKRRREARTGYITLEGFWQDPPHYFENVWPGYVHGHSHLFVNGDVTGKSPSSKMSVRDNVQWAINSILNALQ. 230
11 -19.800[F] COG1102 Cytidylate kinase  ali follow..  11  1.MPKGCLVITVSGLAGSGTTTLCRNLAKHYGFKHV----YAGLIFRQMAKER-----GMSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVIEGRLAGWMVKNADLK------------------------IWLDAPIRVRAERVAKR-----EGISVEEAFMKIAEREMQNRKRYLNLYGIDILIIDTSK--WSPEGVFAIVKAAIDHLYEK 180
12 -19.700[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  11  21...PEGKLILLNGGSSAGKTSLALAFQDLAAECWMHIGIDL-FALPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTR---EWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAEYD--------------FELDTTATP------VHELARELHESYQA 209
13 -18.800[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  16  61.KNDGLILVGLAGPSGAGKTIFTEKILNFMPSIAIIN-------MDNYNDGTRVIDGNFDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEVPSSRI------VILEGIYALSEKLRPL-----DLRVSVTGGVHFDLVKIQRAGQEPEEIIH-----QISETVYPMYKAFIEPDLKTAQIKILNKFNPFSGFQNPTYILKSSKA.... 258
14 -18.500[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  14  9......RTVAILGGESSGKSTLVNKLANIFNTTSAWE-YGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKNKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRF----------------DLVILLENNTPWVADGLRSLGSSVDR-----------KEFQNLLVEMLEENNIEFVRVEEED------DSRFLRCVELVREMMGE 185
15 -18.300[G] COG3265 Gluconate kinase  ali follow..  18  1...MSGKCIIVMGVSGTGKSCVGQALALALGAKFI-DDLHPRANIQKMAAGQPLNDQDRAPWLERLSDVAYSLQQKNEVGFLVCSALK-------------------KQYRDRLREGNEGI---------RFLWLTGDYDLVLHRMQQRAGHF---MPESLLKSQFATLEAPGSD------EPDVIPIDISS-------SIADVVEHCIAALSL 168
16 -18.200[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  12  13...SPGTMIVIVGPSGAGKDTLMDYAAAQLSGR--------------------------GFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPAAVYRHLEAGLPHFGTAFSRLKVVIVARPDVLARRLEQRGRESRDDIL--------RRLERS----LAVAGDFDVTTVD-------NSGAIEDAGKTIMQVLQQ 192
17 -18.100[F] KOG3327 Thymidylate kinase/adenylate kinase  ali follow..  14  6.................RSSSIGQVINSYLTNSKDLPDE------------------VIHLMFSANRWEHINQ--------VKEKLLEGTTLVVDRYSFSGVAYSAAK-----LDFDWCYAPERGLIKPDAVFYLRAPPNDLTHRGQYGKERYEK-------VEFQGRVAEVFNR-ICSKEGSYFHQFDARQ---SVEDLHAQIASITEELLPK 161
18 -17.700[R] COG3911 Predicted ATPase  ali follow..  1MQNDFDRVFVLTGGPGSGKTTLIAALRRA-GFATSVVAVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLGYLRLSGLPVADHVSTAAKRFRY----------------NPRVFIAPPWPDIFAQDEERKQTPDEA----------KCTYHALAEIYTELGYELVPLPLAP------ETRLRFVLADAG..... 181
19 -17.300[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  13  123.SPNLKRLVGLAGPPGAGKSTVANEVVRRVNKLWPQKAASFDA-MDGFHLYRSQLD-TFDPALLLNCLKKLKNEGSVYVPSFDHGVGD----HKVVIVEGNYILLEEGSWKDISDMF------------DEKWFIDVNLDTAMQRVENR--HISTGKPPDVAKWRVDYNDRPNAELIIKSKTNADLLIRSMNI..................... 333
20 -17.300[G] KOG3354 Gluconate kinase  ali follow..  17  10.NQPYKYVFVVIGPAGSGKTTMAKAVSEKLGFEYI-DDLHPKANIEKMLNDNDRWGW---LHNCGGACAMELDKESIKGVVLTCSALK-------------------RSYRDILRSSLEHRPAI------RFIYLAASRETLIKRTTSRKNHYMKADMVESQLAILEAPTA---------DEKDVITISVE-------NGKEQSEEECLDIVHK 185
21 -16.900[C] COG3954 Phosphoribulokinase  ali follow..  11  1.MSAKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVE---GDSFHRYTRP---ANDFSLLEHTFIEYGQTGKGQSRKYLEAVPWNQVPGTFTPWQPLPEPTDVLFYEGLH-GGVVTPQHDVARHVDLLVGVVPIVNLEWIQTSERGHSREA------VMDSVVRSMDDYINYITPQFSRTHINFQRVPTVDTSNPFAAKGIPSLDESFVV 231
22 -16.600[F] COG0283 Cytidylate kinase  ali follow..  2...NRQKVIAIDGPGASGKGTVAARVAAALGYDYLDT--------GALYRLTALYAQKQGVGW------HDEENVSELAKKLPAVFSDSRILLGGEDVSDGIRTEAIGMGASAVAQL-RDTGSVVFPQAELKIFLTAESKI---RAERRAKQIGIPCEGLAFERILSDIEARDEA--RNRKVAPLKQQPDALLLDTSRLTIEETVKKVLDWYRK 217
23 -16.400[F] COG4088 Predicted nucleotide kinase  ali follow..  12  3.......LIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDYRVIIINDESLNIEKETYR------KNEKAARGLLYSAVQRELSKSTFV---ICDALNYIKGFRYQLYCESKSMYTTH---------CVIHVAVPQDLCRKFNSNKEQPYPDDV--------LEQLMFRYEE--MTRWDSPLFTVLHDDASCPIDDIWSVLIHN....... 179
24 -16.100[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  14  8.KLEQPVFLIVAGPNGSGKSSVYANADLELEGRSV------------WIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIG-----ETVLSTDK--------YRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAKGGHDVPADKVRARYARSLDQLPWFLERADR--AWIWDNSGATGLDENALAVVASAVKSIATE 206
25 -15.700[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  10  31.RLMKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGF--------------------RNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLE-IQTYLQSTKPIIDLYEEMGKVKIDAS-------KSVDEVFDEVVQIFDK 226
26 -14.500[H] COG1072 Panthothenate kinase  ali follow..  76.GQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVE----TDGFLHPNQMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPH--DFSIYVDAPEDLLQTWYINRFLKFKEEAIKTAMTLWKEINWLNLKQNILPTRERASLILTKSA---------NHAVEEV--RLRK 308
27 -14.300[S] COG2326 Uncharacterized conserved protein  ali follow..  14  54KKTGARIVIVFEGRDAAGKGGVIKRITERVSPRVFTDREKTQIYMQRYIQQFPA---------------------AGEVVIFDRSWYNRPGVERV---MGFCSEKKAKRFLEIAPRFEAAMIESGIV---LKYFLDVSEEEQDRRFRQRLRQWKLSPMDVESYRRWWDYTRAYDEMIRDTDDAPWWIVPSDNKKQARVNCIAHILSSIPYERVK 255
28 -13.600[R] KOG4622 Predicted nucleotide kinase  ali follow..  14  14.GPRKRGLCVLCGLPAAGKSTFARALAHRLQQEVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLEYFLMAVINGCQMFITCLKDQDLIFSAAFEAQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVQLFLDCPLETCLQRNGQRPQALPPET--------IHLMGRKLEK--KNAWEHNSLTIPSPA---CASEASLEVTDLLLTALEN 249
29 -13.500[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  11  3.......LVVITGLPASGKSTRARQLRDHFV--------ERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVI------------DAGNYIKGYRYELYCMSKVSRTT--CTVFTCIPQEEAWTFNSQRTAPDELP.......................................................... 131
30 -13.300[S] COG5324 Uncharacterized conserved protein  ali follow..  10  386VDERTKFLIFPISVIGCGKTTTSQTLVNLFPGHIQNDDITGKDKSQLMKKSLELLSKKEIKCVIVDRNNHQFRERK-----------------------------------QLFEWLNELKEDYLVYDTNIKVILSEIRDITLQRVIKRGNNHQSIKWDELGEKKVVGIMNGFLKRYQPVNLDKMIELDFGQAD-SSLTNAKQILNEIHKAYPI 583
31 -12.700[E] COG0703 Shikimate kinase  ali follow..  17  66EKMAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYIEKRTGADVGWVFDLEGEEGFRDREEKVINE-----------------------------------LTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRKKRPLLHVETPPR-----EVLEALANERNPLYEEIADVTIRTDD------QSAKVVANQIIHMLES 239
32 -12.300[R] COG3910 Predicted ATPase  ali follow..  35....KTPITFFAGNNGSGKSTLLEGLAAGMTAYYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDEP---------------ESPLSPQKQLELAAIIRQTHSPVLLAIPEATIYYFDEDGIELENIAFLRRFLDRPSKYLDD 258
33 -12.300[F] KOG0707 Guanylate kinase  ali follow..  12  132VRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFS-------VSHTTRSPRSMEMDGVHYHFADKKVMEKEIKDG--KFLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGARSVRAS-SLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIF------GLILYN---------DNLEECYKKLKVNHLL 320
34 -12.200[R] COG4639 Predicted kinase  ali follow..  14  3ITIPELSLVVLIGASGAGKSTFARKHFQPF------EVISSDFCRGLVSNDENSQSASRDAFDVLHYITT-KRLAAGKLTVIDAT---------------NVQPEDRKTLLQMAKQYHCFT---------VAIVFDLPEELCHERNQQRS---DRQFGSHVVRRHTQMLRRSLRSLEKE---RYVYTLKSPEEIANVAIELQPLWNNKKHE... 178
35 -12.200[F] COG0194 Guanylate kinase  ali follow..  17  41.MKERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYS-------ISVTTRSPREGEVNGVDYFFKTRDEFEQMIADNK--LLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLEIEVQGALQVRNAFPEGLFIFL-APPSLSELKNRIVTRGTETDALIE--------NRMKAAKAE-IEMMDAYDYVVEN---------DNVETACDKIKAIVLA 225
36 -12.200[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  11  110LLQQKGCVVWITGLSGSGKSTVACALSKALFERGKLTYTLDGDNVRHGLNRDLTFKAEHRTE--IRRIGEVAKLFADVGVICIASLISPY--RDRDACRSLLPDGDF-----------------------VEVFMDVPLHVCESRLYKLARAGK--------IKGFTGIDDPYEA-----PVNCEVVLKHTGDDE--SCSPRQMAENIISYLQN 287
37 -11.700[F] COG1618 Predicted nucleotide kinase  ali follow..  13  6.KEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKP------GGIRTAEIRKEGHREGFSIR------------------------DLATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVI---------IGPMELISQSFVSAVEEVLESDVLAVLHHSSRHPLAQRFRKGFEVLTVDK------GNRDELPEKITNRFLR 181
38 -11.500[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  12  2......FIVAVTGGIATGKSTISKVFERQIDADKIAREIVERQIREVFGDEVLLPSKEINRAVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGVLMDFI-------HKIVCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSHF----------VIDNNGSVEEAESSAMSIYNLMRDSKQH 202
39 -11.500[F] KOG3078 Adenylate kinase  ali follow..  13  11.EYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLAT------------------------DMLRAMVASGSELGKKLKATMDAKLVSDEMVVELIEKNLETPLCKNGFLLDGFAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRRRSDDNEKALKIRLQAYHTQTTPLIEYYR--KRGIHSAIDAS-------QTPDVVFASILAAFSK 229
40 -11.500[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  11  1...QKPAVLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSDLGFSDADRVE--IRRVGEVARLMADAGLITPVSFIS-------------------------FREERDQVRARLPEGEFIEIFIDTPIEECMARLYAQALRGE--------IKAFTGIDSPYEP-----PVAPELRLNTAG------RTVDELIAEVENYLAE 171
41 -11.400[H] COG0237 Dephospho-CoA kinase  ali follow..  11  3......LVIGLTGGIASGKSTVANMLIEKIDADIIAKQAVERQIIDEFGEDILLSNGDIDRKKLGALVFTNEQKRLALNAIVHPAVRQEM--------LNRRDEAVANREAFVVLDIPLLFESKLESLVDKIIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEKTARADQV-----------------IDNSGTLEETKRQLDEIMNS 195
42 -11.100[F] COG0563 Adenylate kinase and related kinases  ali follow..  15  3........LILMGLPGAGKGTQAEKIIEKYGIPHIST------------------------DMFRAAMKNETELGLKAKSYMDAELVPDEVTIGIVRDRLSQDDCQNGFLLDGFAEALEDILASLDKKLDYVINIDVPEQLLMDRLTGRQRDDDKPETVKKRLEVNQKQAQPLIDFYS--EKGYLQNINGD-------QDISRVFEDINELLKG 214
43 -10.800[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  11  9ADKAKQIVVLLIGPPGSGKSTFCDTAMRSSHRP---------------WSRICQDIVNNGKAGTKAQCLKMATDSEGKSVFIDRC---------------NLDREQRSEFIKLGGPEF----------EVHAVVLELPAQVCISRSVKR-TGHEGNLQGGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDA...................... 161
44 -10.500[R] COG4240 Predicted kinase  ali follow..  10  84.QLKRPFIQGILGSQGTGKTTMSLVIQLILQHLGYRTLSLS---LDDLYKT----------------YSDRLVLLQQDPRLIWRGPPGTHDIDLGLNVLEQIRQGKSPVIVPRFDKSAHAGAGDRT-GVDILIFILTDEDKAFARDMNLRLNHYLPLWE--KLDSLILLYPTDYRCSLEWRKQAEQKMIAAGKTGMSNTQIEEFVNYFWRSLH. 300
45 -10.400[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  12  22FTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQF--ELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLSGGQRARVALLRALLAQPKALL-LDEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHDLQD........................................ 196
46 -9.870[R] KOG2878 Predicted kinase  ali follow..  13  21.PEGRPFILGISGPQGSGKSTLASALDTELTRKNESVVKFS---LDDFYLTHAEQVELAKNNPNNPLVQHRGLAGTHDVTFLNNVLNA---FVKGSDEEVSIPFYDKSKFGGYGDRGDESQWKKANPKTTTYVIFEVGFEPLDSCMLSVRARSTRWQNIEGSLLWVNRKLADYQPIFQKIDSLVELEAQEINYVYRWRLQQEHALEEVIEFVNH 240
47 -9.530[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  12  22LNITQGEVVVIIGPSGSGKSTLLRCINVITRGQLIVDGLDVNSPNIDERQIRLEAGMVFQQFYLFPHLTALENVAFGPTKVRGTSKEEAKKQALALLSKVGLEDRAHHYPAELSGGQQQRVAIARALKPKLMLF-----DEPTSALDPELRHEVLTVMKDLAEEGMTMVIVTHEVGFAQKVASRLIFIDKGRI..................... 214
48 -9.490[D] COG3640 CO dehydrogenase maturation factor  ali follow..  14  1MEGFGMPKLIISGRGGSGKSTLVTLIAHTLKEQLVVDSDESNIGLSGI----------LGIEPAEKTLMDYLGGKPRVMKKLRSMIRDGETEPELFREKFDLESLSQEFVCWVGSLGLMQIGKIDHAMEGCACPMGAVTRDFLNHVRLEEDQW-------VLVDTEAGVEHFGRGIVEGADAV-VMVVDPSSDAVLLAEKAAKLTHEADKRF.. 198
49 -9.470[T] KOG0609 Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase  ali follow..  14  341MPPFRRKTLVLIGVSGVGRRTLKNRLINS-------DVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNN--EFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSQELMP-FVIFVAAPGMEQLKTIYADRRATGSLCLNTQTLLNTSFVQRKYEKYF------DMVIVN---------EDFDETFRQVVETLDQ 562
50 -9.400[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  14  1MKNQSEINIGLVGHVDHGKTTLTKALSGV----------------TDTHSEETKRGISIRLGYADITFRKCPQCEAPMCY---TTAEICERCGTETELLRKVSFVDAPGHETLMATMLSGAALM-----DGAILVIAA---------------NEPCPQPQTKEHLMAL---------DVIGVKDVIVVQNKIDIVSKERALESYREIKEFVK. 166
51 -9.310[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  14  61.RNRKDKVVVILGATGAGKSRLSVDLATRFPSEIISDKIQVYEGLEITTNQITLQDRRGVPHHLLGVIEFRSAASNVVKEITSRQKVPIIAGGSNSFVHALLAQRFDPKFDP--FSSGSCLISSDLRYECCFIWVDVSETVLYEYLLRR-------VDEMMDSGMFEELSRFYDGYFKEYPPEKKMIKWDALRKAAYDKAVDDIKRNTWTLAKR 297
52 -9.240[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  22FTLNAGEWVQITGSNGAGKTTLLRLLTG------LSRPDAGEVLWQGQPLHQVRDSYHQNLLWIGHQPGIKTRLTALENLHFYHRDGDTAQCLEALAQAG-LAGFEDIPVNQLSAGQQRRVALARLWLTRATLWI---LDEPFTAIDVNGVDRLTQRMAQHTEQGGIVILTTHQPLNVAESKIRRISLTQTRA..................... 204
53 -9.120[O] KOG0741 AAA+-type ATPase  ali follow..  12  256........ILLYGPPGCGKTLLARQIGKMLNAREPK--VNGPEILNKYVGESEA---NIRKLFADAEEEQRRLGANSGLHII---IFDE---IDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGR-LEVKMDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNR 455
54 -9.080[R] COG0802 Predicted ATPase or kinase  ali follow..  19  26...LAGDVITLEGDLGAGKTSFTKGLALGLG---IKRVVKSPTFLPLYHMDVYRLNEEEEDLGFDEYFHGDGVTVVEWASLIEGRLPPVRLAITITHAGENERQLSFTAYGERWEEVLKELLDH.......................................................................................... 152
55 -9.030[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  33  2...KRPLIIGVGGPVGAGKTMLIERLTRYLSTK..................................................................................................................................................................................... 31

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.