current user: public

If you have questions about the server, please let us know.

Query: [C] COG1592 Rubrerythrin, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MGTLENLVKAFIGESMARNRYTFYAKVAKDEGYVFIQRVFLETAENEKEHAENLLKFIQQLRGDNAAIKVEAEAPLVWGTTVENLKAAIEGEHYENSEMYPQFADEAEKEGFKDIADRLRAIGKAEEHHERRYRRLLAEVENGTFFKRDKEIAWVCLECGYIHYGTEPPEECPSCGHPKAYYVAEDLLSLLast
1 -84.000[C] COG1592 Rubrerythrin  ali  100  1MGTLENLVKAFIGESMARNRYTFYAKVAKDEGYVFIQRVFLETAENEKEHAENLLKFIQQLRGDNAAIKVEAEAPLVWGTTVENLKAAIEGEHYENSEMYPQFADEAEKEGFKDIADRLRAIGKAEEHHERRYRRLLAEVENGTFFKRDKEIAWVCLECGYIHYGTEPPEECPSCGHPKAYYVAEDLLSL 190
2 -38.900[P] COG2193 Bacterioferritin (cytochrome b1)  ali follow..  19  6.KVIERLNEALFLELGAVNQYWLHYRLLNDWGFTKLAKKERAESIEEMQHADKIIDRIIFLEGHPNLQTLAPLRIGQ--NVKEVLEADLAGEY-DARTSYKKSRDICSEAGDYVSMKLFEALLIDEEGHIDFLETQLELLGKIGA............................................. 146
3 -35.100[P] COG1528 Ferritin-like protein  ali follow..  16  5.AIAEKLNEQINLEFYSSNVYLQMSAWCAHHGYEGAAAFLLRHADEEMEHMQKLFNYVSETSGMPLLGKIEA-PKNDYKTLKEIFEITLEHEK-FVTSKINELVEVTFAHKDYSTFNFLQWYVAEQHEEEMLFNSIIDKFNLLGE............................................. 146
4 -34.000[R] COG2406 Protein distantly related to bacterial ferritins  ali follow..  18  18.KLLELLIKNAAAELTTYYYYTILRANLIGLEGETIKEIAEVARIEDRNHFEALVPRIYELGGKLDLSACPPARLPDKPTVQEILRVLVAAER-CAVKGYTEICNMT-AGKDHRTYELSLAILNEEIEHESWFSEFLGEGPS................................................ 164
5 -23.700[S] COG1633 Uncharacterized conserved protein  ali follow..  15  17.GIEEAIALAIDREKEAREFYLQQAGLMEN---PKFKELYEELAAEEMKHLGYLENYRDKKELPEISTEVPSGQSEITLGDAGILLAAMRHER----KSEDFYSEMAKRVEDETQKKFFEMLSRYERGHYEVIDSYLEYITQ................................................ 163
6 -22.700[S] COG4902 Uncharacterized protein conserved in archaea  ali follow..  15  49.EEANSLLYMIEEEKLARDVYLKLYNETGL-------IIFDRIAQSEQRHMDAVLMLIEKYNLTAPDTLYNELVEMGSQSVVDALKVGALIEE----IDIKDLEEWLSKVDNEDIKVVFENLMDGSKNHLRAFTKVLADN.................................................. 190
7 -20.100[P] COG3546 Mn-containing catalase  ali follow..  18  20.GLANLLLEQFGGELAAACRYFTQGLSDDD---AGRREMLMDIATEELSHLEIIGSLVGMLNKGAKGELAEGTENEA-GEVTADLRSNIAAEA-RAKIIYERLINLTD---DPGVKDTLSFLMTREVAHQLSFEKALYSIRN................................................ 197
8 -17.800[S] COG2833 Uncharacterized protein conserved in bacteria  ali follow..  12  81.GRIALMHALAHIELNAIDLALDIVARFAVKPIPSFFDGWMKVADDEARHFTLLRNRLKSLGADYGDMPAHDGLWQSAHQTRNDLEARLAVLEARGLDVTPSLLEKMIETGDHETAAILNIIYNDEKTHVAVGAKWFRFFARNRIDPAARFRELVRANFRGELKPPFNELARAEAGLTPSFYRSLSPVSI 275
9 -15.300[P] COG0783 DNA-binding ferritin-like protein (oxidative damage protectant)  ali follow..  15.KIAESLKKLLADTYTLYLQTHNFHWNVTGPQFRDLHLMFEEQYNELALAVDDIAERIRSLDVFAEFAKLSSVQEVDGIPTSKEMVDILTKGHETIVQSCRDVLKCSQPADDESTIALASDRMRVHEKTAWMLRAMNK.................................................... 156
10 -14.800[S] COG3685 Uncharacterized protein conserved in bacteria  ali follow..  19  1MATANELRDAHAMEEQAITMLTSQSSRLENY--PELKTRIDRHLQETKDQAAMLERCLERLDGGTSSIK-GLSGLFVSDEVVKGTLASYTFEHMEIAS-YRILIAAAEQAGDQETKRVCESILQQEIAMAEWLAQNAGEI.................................................. 152
11 -14.300[S] COG3461 Uncharacterized conserved protein  ali follow..  18  17.RDFVRALNSLKEEIEAVAWYHQRVVTTKD---ETVRKILEHNRDEEMEHAAMLLEWLRRNMPG.............................................................................................................................. 76
12 -13.900[S] COG1814 Uncharacterized membrane protein  ali follow..  22  8.KLVEVARKAALDEYKEYVTYSVLARVERN---KARRAVLERLAEQEREHFQFWNKFAVKPPAWRFRLYAYFMAFLRLILGVTFVAKLMERGEEAIARYKSAEPLLSGPD-----REALRRIIKDEEEHERALIAQLDE................................................... 138
13 -13.400[H] COG2941 Ubiquinone biosynthesis protein COQ7  ali follow..  14  43..LDSVIRVDQAGELGANQIYKGQHFILQFTD-PKVAPTIQHMWDQEKYHLATFDNYVLKNRVRPTFLRPFWDIAGFALGAGTALMACTEAVETVIGGHYNDQLRETKAPEFKEIRSHLAEFRDDELEHLN........................................................... 181
14 -13.400[R] KOG4061 DMQ mono-oxygenase/Ubiquinone biosynthesis protein COQ7/CLK-1/CAT5  ali follow..  14  43..LDSVIRVDQAGELGANQIYKGQHFILQFTD-PKVAPTIQHMWDQEKYHLATFDNYVLKNRVRPTFLRPFWDIAGFALGAGTALMACTEAVETVIGGHYNDQLRETKAPEFKEIRSHLAEFRDDELEHLN........................................................... 181
15 -13.100[C] COG1773 Rubredoxin  ali follow..  34  2..................................................................................................................................................SAEPFKVWQCRTCGYIYDEADIPAVCPLCGTPKSDFDMIEL... 59
16 -11.000[G] COG2956 Predicted N-acetylglucosaminyl transferase  ali follow..  15  198.RAMTLLKKGAAADKNSARVSIMMGRVFMAKGYAKAVESLQRVISQDRELVSETLEMLQQLGKTAEWAEFLQRAVEENTGADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEAEEGRAKESLMVLRDMVGEKVRSKPRYRCQKCGF--TAYTLYWHCPSCRA............. 376
17 -10.700[K] COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon  ali follow..  12  8....................................................................................................EKIVSLLTESREPLTIEEIAYMVGEDDKSK--IIEDLEHIAKTLRREGKTLLM-RCNKCGYVFKSLKPPSRCPKCKSEW........... 88
18 -9.780[S] COG3396 Uncharacterized conserved protein  ali follow..  11  30.TLIRQIGQHAHSEIVGMLPEGNWITRAPT----RRKAILLAKVQDEAGHGLYLYSAAETLGCAREDIYQKMLDGRMKYSSIFNYPTLSWADIGVIGWLVDGAAVALCRTSYGPYARAMVKICKEESFHQRQGFEACMALAQGSEAQKQMLQ...................................... 181
19 -9.070[K] KOG2845 Activating signal cointegrator 1  ali follow..  10  16..CTQQLRKTFGLDVSEEIIQYVLSIESAEEIREYVTDLLQGNEGKKGQFIEELITKWQKNDQELISDPLQQCFKKDEILDGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTRERQDRLAVAL---CLICGRIVCEQEGSGPCLFCGTL............ 206

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.