current user: public

If you have questions about the server, please let us know.

Query: [F] COG1618 Predicted nucleotide kinase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MRIEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDEIGPMELISQSFVSAVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFLRKLGLast
1 -73.900[F] COG1618 Predicted nucleotide kinase  ali  100  1MRIEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDEIGPMELISQSFVSAVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFLRKLG 184
2 -19.300[S] COG3854 Uncharacterized protein conserved in bacteria  ali follow..  21  125...........SILMLGRPGVGKTTALREIARVLADELHKRVVIIDTSNEIAGDGDVAHPAIGRAR-----------------RMQVAHPELQHQVMIEAVENHMPEVIVIDEIGTEL------ALAARTIAERGVQLVGTAHGNQIENLIKN............................... 244
3 -17.000[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  11  14LAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAEC--MHIGIDLFWFALPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDV----IWTREWLVDALRVFEGCRVWMVGVHVS-DEEGARRELERGDELDTTATPVHELARELHESYQA... 209
4 -16.400[F] COG2019 Archaeal adenylate kinase  ali follow..  13  1..........MRSVITGVAGVGKTTVLDIVARES-----------------------GIPVVNYGTLMFEVAKRRGLVENRDQIRKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWVLRSINASVFVIIEADPAIIKRRRDNDVKIVKNEEGKPEQAADEIVRVIK.... 181
5 -16.300[L] COG0507 ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member  ali follow..  15  54.....KGGRSQLFRLFGYAGTGKTTLARHFAENVDGEVVFAATGKAAQVLRSKGATNAKTIHSL-------IYRPRGEEEVEDEETGKTSIAPMFAINRQSPVAKAALIIVDECSMVDE------ALGKDLMSFGTPILVLLPPVSGGGYFTNHEPDFLLTDIHRQARDNPIIQLAMQVRE... 222
6 -16.300[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  10  33.....SADCMPHLLFCGPSGAGKKTRIKCLLRELYGVGVEKTQ--LIMKSFTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTSQIESTSQRSFKVVVLCEADSLTRDA---QHGLRRTMEKANNCKIVLSCESLSRIIEPLQSRCIIINVPAPTDEDVTKVLRKVIER... 204
7 -15.700[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  15  4.....KPFFVRTVAILGGESSGKSTLVNKLANIFNTT---------------------------EYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSNIEFVRVEEEDYDSRFLRCVELVREMMG 184
8 -15.600[R] COG3911 Predicted ATPase  ali follow..  13  2.....QNDFDRVFVLTGGPGSGKTTLIAAL-----RRAGFATSVVAGRGIVRDQSSIGGTALPWSDRTL-----------------FAELMLSWEMRSYQNAVEQKGPVFFDRLGYLRLSGLPVADHVSTAAKRFRYNPRVFAKCTYHALAEIYTEGYELVPLPLAPVETRLRFVLADAG.... 181
9 -15.500[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  12  1......MKRPLIIGVGGPVGAGKTMLIERLTRYLSTK-GYSMAAITNDIYTKEDARI---LLNTSVLPADRIAGVETGGCPHTAIREDASMNFAAIEEMCDKHPDLQLLFLESGGDNLSAT-----FSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKSDLFIINKVDLAPYVGANVEVMKADT. 168
10 -15.100[LO] COG1474 Cdc6-related protein, AAA superfamily ATPase  ali follow..  11  56LVSALRGETPSNVLIYGKTGTGKTAVTRYVGKELERVSEDKSLFCSVVYI---------NCEVIDTQYRLLANLARHFEEEVPMTGWPTDQVFMKFKEAIDARDQVIIIILDEIDKLIKKGDDVLYNLSRI-KAKVSMIGVSNDLKFTEFLDKSSLGEEELIFPPYDAEQISDILKQRAKMAY. 236
11 -15.000[L] KOG2028 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  12  128LRSAVESNRLPSIVFWGPPGTGKTSIAKSLINSSKDPSLYRFVSLSAVTSGVKDVR----------------------------------DAVESAKRLNLEGRKRTVLFMDEVHRF---NKSQQDTFLPVIEDGSLFIGATTENPSFHLITPLLSRCRVLTLNPLKPNHVETLLRRAVDD... 272
12 -15.000[R] COG2229 Predicted GTPase  ali follow..  13  5...........KIIFTGPVGVGKTTAIAAISDEALVQTDASASDMTLDRKRNTTVAMDYGAISLDEDTKVHL------------YGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDEFFLHSFRGLLEKAPVVVGITKMDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSI.. 172
13 -14.900[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  124...RQPKQGGSILLITGPPGCGKTTTLKILSKEH----GIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIA--VFKEFLLRATKYNKLQMLGDDLRTDKKIILVEDLNQFYRDSHTLHEVLRKYVRIGRPLIFIISDSLSGDNNQREECSISNISFNPVAPTIMMKFLNRIVTI... 305
14 -14.700[R] COG3910 Predicted ATPase  ali follow..  13  28.HLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDIMHRRLHGAGLYFLDE-SPLSPQKQELAAIIRQAADSGGQLIIATHSPVLATIYYFDEDGITERLYDELENIAFLRRFLDRPSKYLD 257
15 -14.500[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  13  42LRRALEAGHIHSMILWGPPGTGKTTLAEVAANYANAE---------------------VERVSAVTSGVKEIRAAIEK------------------ARENKLSGRRTILFVDEVHRF---NKSQQDAFLPHIEDGVTFIGATTENPSFELNNALLSRARVYKLTSLNQQEILQALHQAIAD... 181
16 -14.500[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  16  60LEVFAREGNVPNIIIAGPPGTGKTTSILCLARAL------------------LGPALKDAMLELNASNDRGIDVVRNKIKMFAQ------------QKVTLPKGRHKIIILDEADSMTDGA---QQALRRTMEISKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEK... 208
17 -14.200[L] COG0470 ATPase involved in DNA replication  ali follow..  15  37VRKFVDEGKLPHLLFYGPPGTGKTSTIVALAREI------------------YGKNYSNMVLELNASDDRGI-------------DVVRNQIKDFASTRQIFSKGFKLIILDEADAMTNAA---QNALRRVIERTKNTRFCVLANYAHKLTPALLSRCTRFRFQPLPQEAIERRIANVLVH... 184
18 -13.800[R] COG4128 Zonula occludens toxin  ali follow..  14  1.........MSIFIHHGAPGSYKTGALWLRL----------------LPAIKSGRHIITNVRGLNLERMAKYLKMDVSDISIEFIDTDHPDGRLTMARFWHWARKDAFLFIDECGRI-WPPRLTVTNLKALDTPPDLVAEDRPESFEVAFDMHRHHGWDICLTTP-NIAKVHNMIREAAEIGY. 157
19 -13.800[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  15  1..........MLIAITGTPGVGKTTVAKLLAKKLNYE-------YVSLKDFALEKGCGRRVNDEVEVEIDELAYFIERELKGKN--------------AVLDGHLSHLMPVDLVVVLRAHPKLIGERLRERGYDREKIGENVEAELVDAVLIEAIENVIEVDTTNKSPEDVVEEIVSLINS... 153
20 -13.600[R] COG1084 Predicted GTPase  ali follow..  13  154.NMPTVDLDAFTVVIAGFPNVGKSTLLRTLTGAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPG---------------LDRPVEDMNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLYLGIRSFDIPVVTVFNKKYLEEYINMVEDPLKVSAFEGRGVSKIIKKLEGLYEK... 327
21 -13.500[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  17  31..RADISQVGKHLLIEGPSGIGKTCVVFKVFEELQWSQGRDFTYVGCRDQNAEQIIDDFL-----------------------------------KNAAAGNALSPCVLVIDDFHLLSQAKRMEIGSTLKRLEPAKVILIGIPTAGVSLLSDALGPRLGSYALTRASDVEI-DKLISEGEQALA 186
22 -13.500[L] KOG1968 Replication factor C, subunit RFC1 (large subunit)  ali follow..  18  403...PDGLGLYKAVLLSGPPGIGKTTAAHLVAKLE---------GYDVLELNASDTRSKRLLDEQLFGVTDSQS---------------LAGYFGTKANPVDMAKSRLVLIMDEIDGMSSGDRGGVGQLNMIIKKSMIPIICICNDRAHPKLRPLDRTTFDLRFRRPDANSMRSRIMSIAYR... 556
23 -13.500[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  15  63IDRLTNENKLPHLLLYGPPGTGKTSTILAVARKL------------------YGPKYRNMILELNASDDRGIDVVRQQIQDFAS-----------TQSFSLGKSSVKLVLLDEADAMTKDA---QFALRRVIEKTKSTRFALIGNHVNKIIPALQSRCTRFRFAPLDGVHMSQRLKHVIEA... 212
24 -13.500[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  16  48..AKQRGDALDHVLIFGPPGLGKTTLANIIANEMGVNLRTTSGPVLEK--------------------------------------------AGDLAAMLTNLEPHDVLFIDEIHRLS---PVVEEILYPAMEDYQ--LDIMIGEGPAARSIKLDLPPFTLIGATTRAGSLTSPLRDRFG.... 176
25 -13.300[L] COG1484 DNA replication protein  ali follow..  13  111...QIKDCRKNSIALLGQPGSGKTHLLTAAANELMRTCYVPVIYFPFVEGFTD-----------------------------------LKNDFALLEAKLNRMKQADVLFIDDLFKKPRATDWQLEQMYSVLNYR---------------YLNHKPILLSSELTIEGLVRVDEALGTKIYEMCS 245
26 -13.200[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  13  2........LLPNILLTGTPGVGKTTLGKELASKS---------GLKYINVGDLAREEQLY-DGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFV-----LRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEESYKEEIVHQLPSNKPEELENNVDQILK.... 161
27 -13.200[T] KOG3886 GTP-binding protein  ali follow..  11  32.WVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSH-------------------VRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKM..... 190
28 -13.200[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  10  36..........SLTLIEGENDTGKSVLCQQFVYGGLMSGHNIA----IKSFLRQMESLSLDVSDFYAWGYLRVFPVHLEGIDWSTEQMRS------LVANHIKTIRENIAIIDSLTMFTTYSTEFLTRLKNLCDNGKTILITLHQHAFKEDTLVRIRSACHLFLRKEQVGDRYVSVLEVSK.... 212
29 -13.000[R] COG1855 ATPase (PilT family)  ali follow..  17  273......VERQRGILISGPPGAGKSTFAASVANFLLEN--------------------GYIVKTMESPRDLMVRDEITQYAPLEGDMSLTSD--------ILLLVRPDYTIYDELRRTSD-----FQVFADMRLAGVGMIGVTHATRAVDAIQRMIGRVEL--MIPQVVDTVVFIDAGRIVKVYE 416
30 -12.900[LD] KOG2227 Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase  ali follow..  11  140VKGCIDQQKAGSLYICGCPGTGKSLSMEKVVQQVGDWS-------------TQAGLPPVDTLSVNCTSSKILGEIKPGKNANTNSSPLQHLQNLFSQKQESSSSRMMLIIADEMDYLITKDRGVLYDLFMLTTLPFSRCILIGVANAIDLADRFLPKLMVITFRAYSKDQILRILQERLRV... 322
31 -12.800[L] KOG2228 Origin recognition complex, subunit 4  ali follow..  12  566VRQTIVLGEGNSVIIVGPRGSGKSVLVDDILSRAAQEINVRLNGTYQTDDKLALREISRQLLESIESDEALKSEMNFSDTLTKLLATLSHPVDLGIAEDVMTTSAAVIFVLEEFDLFVQHSRQ--MLLYNLFD----------------IAQSRKAPILIIGLT--TRYDCSESLEKRVKSRFS 737
32 -12.800[G] COG2074 2-phosphoglycerate kinase  ali follow..  12  87.....QCKEPLIILIGGASGVGTSSIAFEVANRLGIRN-------VMRKIVSRELLPSIYESSYTAYQSLRIPPPPELDEVLIGFRDHVESVSIGVEAVIERALTEG-IVIEGVHIVP-------GFIREDLVNKENVAMFVAIRRIHRYIENQARKHGVPVIENIDVVTTIDSIIKSLTKTT. 294
33 -12.800[L] KOG2543 Origin recognition complex, subunit 5  ali follow..  13..LFNNSRIISHVHIFGEDGSGRSEIVRQLLRKPENDW--------------------LGDFLYADGSLKLLFDSLASSLGFKTRGDRAENFCDNLYKYVQWPDETNVIFLDNAQAITDYPPVPLQCLFDSYKATIRFVTSAPSCLNQYHINLSHLPVVEFHIPAPSVETTKVLISRANPK... 181
34 -12.700[R] KOG4622 Predicted nucleotide kinase  ali follow..  11  14.....GPRKRGLCVLCGLPAAGKSTFARALAHRLQQEQGWAIGVVAYDDVMPDAVINGCQMSVPPNRTEAMWEDFITCLKDQDLIFSAAFEAQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLE-------------TCLQRNGQRPQALPPETIHLMGRKL. 209
35 -12.600[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  15  74TEQFIVGRPANNVLMSGARGTGKSSLVKALLHEYADK--------------------GLRLIEVDKSDLIGLPY----------------------LTLLKECPEKFIVFCDDLSFES--GDETYKALKTALDGNVLVYATSNRRHLMPEYFDENAGTTGMRGEIHQKEAVEEKIS........ 213
36 -12.600[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  12  1.........MNIFGITGWKNSGKTTLTEKLVAELVRR------GWKVSTVKHAHHDFDIDKPGADSFRHRQAGATEVAIVSGNRWALMHEL-EPPLESILSRLAPCDIVLVE--GYKRESHRKI--ETRRLEAKDRTPLSAGDPNIVAIAADFAVTDKSLPAFDLDDVKSIVDFIERTTG.... 164
37 -12.500[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  14  7.DSRRTLSPGTMIVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVSWQAHGLKY-------GIPAAVYRHLEAGDVVIANSRSALPHFGTAFSRLKVVNIVARPDVLLEQRGRESRDDILRRLERSSLFDVTTVDNSGAIEDAGKTIMQVL. 190
38 -12.400[R] COG1672 Predicted ATPase (AAA+ superfamily)  ali follow..  13  12LERRYEMGGPEFIVIYGRRRVGKTALLLEFIS----------------------RHGGIYLLARETSNLENLKRFSDRLSEYFGDDFLKRNPDAFLEYLNQKATERLVVVIDEFPYLVKGDRSLPSILQEYWDSNGRIFLIICGSSISMMEKLLGYKSPIY....................... 157
39 -12.200[U] COG3267 Type II secretory pathway, component ExeA (predicted ATPase)  ali follow..  14  46............AMLTGEVGTGKTTVARAILASLPGKTRA---GMILNPTFSDLELLEAICDEFE--SYPKKATLKKLTQVLHEFLLAEHAQGIQVLLMIDEAQHLAPDVLEQLRLLTNLETESHKLLKVLLIGQPELQEKLRLPQLRQLAQRITGR---YHLLPLNEEQTADYIRFRIE.... 206
40 -12.200[F] COG4088 Predicted nucleotide kinase  ali follow..  11  1.........MPLIIVSGYPSSGKTTRSNELKKALEDRIH------QNIDNTKDYRVIIINDESLNIEKETYRESKNEK-----------AARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLYCESKSM---YTTHCVIHVAVPQDLCRKF----------NSNKEQPYPDDVLEQLMFRY. 144
41 -12.100[J] KOG0469 Elongation factor 2  ali follow..  18  11.ALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKS-----TAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLINLIDSPGHVDFSSE--VTAALRVTDGALVVVDCVCVQTETVLRQAIAERIKVLFMNKMDRQLGAEELFQTFQRIV. 194
42 -12.100[R] COG5271 AAA ATPase containing von Willebrand factor type A (vWA) domain  ali follow..  15  143NRITPYLVQKRPILLAGPEGIGKKFLITQIAAKL----GQQIIRIHLSDSTDPKMLIG------------------------TYTSPKPGEFEWQPGVLTQAVITGKWILFTNI---EHAPSEVLSVLLPLLEKRQLVIPSRGE------TIYAKGSFQMFATSSMKTKILGQRLWQILDLTYQ 289
43 -12.000[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  15  31.....RLMKPLVVFVLGGPGAGKGTQCARIVEKYGYTH-LSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVE------------ITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNN---EICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTK. 192
44 -12.000[NU] COG2805 Tfp pilus assembly protein, pilus retraction ATPase PilT  ali follow..  18  130............ILVTGQTGSGKTTTLAAILDLINRTRAEHILTIEDP------------IEYVFPNVRSLFHQR--------QRGEDTKSFSNALRAALRE--DPDIVLVGELRDLET-----IALAITAAETGHLVFGTLHTNSAAGTIDRM-----LDVFPANQQAQIRAMLSNSLLAVFA 269
45 -11.900[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  17  40.ESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGFQQDALMPWKTVLENVAIGLEIAGTPKAKAREQAREWLNKVGLGTFG-LSGGQRKRVGLAQVLIRNPKYLLMDEFGPLDAQTRVMGDLLLDLWSQDKKAVMFVTHDLEEAIALADR----VVIMSAGPRARIMAEYRIPLAR... 241
46 -11.800[T] COG5635 Predicted NTPase (NACHT family)  ali follow..  49.......AEIPCLVLLGEPGVGKTHELEKLQRFTE-----------------ETICEYSKVLGLNLRTFTNLKEDLFRDKTFSDW---------------LEGHYHLHLFLDSLDEGLLNVKSLAIGLVDEFKKRLHLRLTCRTLAFPSILEEAESNFAIYELAPLRRIDVSDDFLKAINQ... 214
47 -11.800[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  14  35...SNFKKKPIIIIVVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGANIDIRDTVKYKEVMKQYNLPNGGILTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIEIFTSASGAIITEAFASTFPTVVTYVVDTPRSSSPITFMSNMLYACSILYKTRLPLLAFNKT..... 213
48 -11.800[R] COG1373 Predicted ATPase (AAA+ superfamily)  ali follow..  14  41..SELKFDRDRIYTLRGPRQVGKTTLVKLIIREL---------------LETIEHSQSIFYFTCDLVADEKELF---------------EVLDLYLKWAAAFRLERKYIFLDEISSVR----DWEKGLKYLVDTGNNATVVLTGSHSIDIKSSIE--------RLPGRRGEGEGTLDKIFFPMK 182
49 -11.700[F] COG1428 Deoxynucleoside kinases  ali follow..  13  2.....EGVGNKVIVLAGMIGAGKSSYTELIANELGTKA----DNRILEMFYDDPKRWAFALQSIYEDALFTQINFEEGNISEPEMDTYLDLLDNMMEELAYMPKKAPDLLI--LSRISLRGRPYEQTFDNPGLLD--YYKHLHSRYDSWFESYDKSDTLVINIDESDAKYVMQLIHEKLKR... 214
50 -11.700[NU] COG5008 Tfp pilus assembly protein, ATPase PilU  ali follow..  19  134............VVVVGATGSGKSTTLAAMVGYRNAHSYGHIITIEDP------------VEYVHAHHNCVVTQR--------EVGVDTESWHVALKNTLRQ--APDVILIGEIRDRDT-----MEYAIQYAETGHLCLATLHANSSNQAIDRI-----INFFPEERRQQLLIDLSLNLRAMIA 273
51 -11.700[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  11  5VGDSSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDK-------------------------GKVVKEVRQADAIVLDRPETLDRLSKYWLPLFRQLEVRVPIIVAGYEVDNKEALMKQYREVETSIQWSAQRLDQAKDVLYYAQKAVI. 178
52 -11.700[N] COG1419 Flagellar GTP-binding protein  ali follow..  13  163VKTNAPDFKNAKVLFVGTTGVGKTTSLAKLAARFKIDEKKRVAILTLEQLKIYADIMDIPMKIAYTPKEA--------------------------EYEMMALKDYDIVLVDTAGRSH-QNDLQMSELRALSEAVKPLSMNYKLDDMKRIVERFSAKPTHIILTKMDETSVYGTFVNISEI... 331
53 -11.600[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  17  1.........MPLVVITGLPASGKSTRARQLRDHFVERG-----------------------VHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVS..................................................... 101
54 -11.600[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  14  57.LLAQKNDGLILVGLAGPSGAGKTIFTEKILNFMPSIAIINMDNYNDGTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEV---PSSRIVILEGI------------ALSEKLRPLLDLRVSVTGGVHFDLVKRVLRDI-------QRAGQEPEEIIHQISETV. 217
55 -11.500[R] COG1444 Predicted P-loop ATPase fused to an acetyltransferase  ali follow..  10  231EVFYHKPKKKQALVIIADRGRGKSAALGLGLAGIGHKLRKAKARIVVSAMEYSNLETLLEFALKGLEALGYKPGVEREGGEIRAIKASGIFIDVVTPYMLLKRENADIVAIDEAAGVPL------PVLYAVHKKFNRLVFAFSIRFLKYLKEARDTDVYLYEMEEPIRYGRGDPVEEWLFDAF. 421
56 -11.500[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  24.KTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQLDGFP----CFVEHKLQGEEGDLDLVSFIALDEELQSTSREEDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLDETNHLDVSNVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTD------IIHYENKKLAYYKGNLAAFVEQK.. 212
57 -11.500[H] KOG2743 Cobalamin synthesis protein  ali follow..  17  36...SGLGAKIPVTIITGYLGAGKTTLLNYILTE---------HSKRVAVILNESGEGSALEKSLAVSQGGELYEEWLELRNGCLCCSVKDNGLRAIENLMQKKGKFDDILLETTGLADLGSDIYLDGIITIVDS-KYGLKHLTEEKPDGLINEATRQVALADIILINKDLVPEEDVKKLRTTIR 221
58 -11.400[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  12  14...........KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDG-------------------------INAQCAIIMFDVTSRITYKNPNWHRDLVRVCENIPIVLC--RKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAG 172
59 -11.400[E] COG4917 Ethanolamine utilization protein  ali follow..  10  1.........MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKGDIDT--------------------------------EYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLD-----IGVSKRQIAVISKAATRKLLLETGFEEPMFELNSHDPQSV-QQLVDYLASLT. 146
60 -11.300[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  11  79......DENSKVICVEGPIAAGKSKFAKELAEELDME-------YYPAVDLDL-NSYGYDMRKLDPQ-RNFCLDPSHDLAAQFQIRMYMLRYSQYIDALQHVLSTGQGVVLERQGYLSRGARSVYNELRQNTIGEKPHLVIYLDLPVDAVKKQIKARNV----YEVQSKVFSDAYLSDLEQ... 270
61 -11.200[L] KOG1514 Origin recognition complex, subunit 1, and related proteins  ali follow..  16  414..ISDDQCLGRCMYIHGVPGTGKTISVLSVMKNLKAEV-------------EAGSVSPYCFVEINGLKSVIYEGLSGHRVGWKKALQSLNERFAEGKKIGKENEKPCILLIDELDVLVTRNQSVLYNILDWPTKPNSKLVVLGIANTMDLPEKLLPRISRLCFGPYNHRQLQEIISTRLEG... 593
62 -11.200[H] COG1239 Mg-chelatase subunit ChlI  ali follow..  12  78...........NFILLGLRGQAKSRILRAITELLDPEVPVIDGVDMPDDPLNPIGAEGQHLLEAHGMELPIRWLPRADRYVEKLATPDVTVADLIGDVDPIKAANRGIFAVNELADLS-------PKVQVAL------FNILQEGDVQIKGYPIRLELDVMLVFSANPEDIVTPLKDRIGSEI. 262
63 -11.200[F] KOG0707 Guanylate kinase  ali follow..  13  128WSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVS--HTTRSPRSMEMDGVHYHFADKKV------------------------------MEKEIKDGKFL---EFASVHGNLYG-IESVEAVTDSGKRCILDIDVQGARSVRASSLDAIFIF-VCPPSMKELEDRLREQIQKRLR 283
64 -11.100[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  14  107...DSASSQGPRVIIVGDIDSGKSTLAKMLLNWAVKQSSITIPGTIAAAPIKMLVDPVEGFPLDKALIHYFGLTNPSVNLRLYRTLVEELARELKEEFSANAESRASGMVIDTMGFIVREGYALLLHAIRTFNASL-VIVVGQEEKLVYDLKKNLKFKKNLQVLNLEKSEGVFSRSSDFRKTL. 298
65 -11.000[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  12  84..LEFAQIANCLATVYGMSGVGKTKAIQEFAKSHANV-----------------------LVTASPSRSSLSEILYEIALELGISDAPRRKGTLSRLIARKIKGTEGLLIVDEADHLPYEALEELRIMQEEAGIGLVLVGN-PSHEYARLWSRVAKNTSIQKTKKADTQAVAQA.......... 244
66 -11.000[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  13  51.....RRTKSNTVLLSGLSGSGKTVLFYQLRD------------------------------------------GSSHQGAVTSMEPNEGTFVLHNENNTKKGKVKPVHLIDVPGHSRLI-----SKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNASNKTDKVTAHKEFIRKQME 195
67 -11.000[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  14  58.....STEVKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLE--ICREDVSNSSFVNFQIWDFPGQIDFF---------------------PTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKTDINFEVFIHKVDG---------------LSDDHKIETQRDIHQRANDDL. 204
68 -11.000[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  12  2......TRKTIIVGVSGASCSGKSTLCQLLHAIFEGSSLVHEDDFYKTDAEIPVKNGIADLHYIRDHGVLPTLRNRENKNVAPEALIEYADIIKEFKAPAIPTLEQHLVFVD--GFMMYVNEDLINAIRLMLVTDFDTLKRRREVNGDVTGKLLDKRIQLSPSSKMSVRDNVQWAINSILNAL. 229
69 -11.000[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  16  1MKIMASQKPHLNLITIGHVDHGKSTLVGRLLYEHGEIPAHIIEEYRKEAEQKGKATFEFAWVERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADILVISREGEGVMEQTREHAFLARTLGVPQMVVAI------------NKMDATSPPYSEKRYNEVKADAEKLLRS... 178
70 -11.000[R] COG0645 Predicted kinase  ali follow..  14  4............AVTHGVSAVGKSQVAMRLVEALSDIERKRLFGEQPEH-DRGQFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASL-DGLVDGIRQRLP 183
71 -10.900[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  11  23VEKIESLRKPAKVMIIGDVDTGKTTLTIYLANELLSQKGILPPATISLAFVDS--------FTSLDDLKAFSHYFIGTITPNQYFGEMVVGVMKLSELAMKFSDV---VLIDTTGMIYGSGVELKRMKIEAVKPNL-ILALERNNELAPILKGYEDITIRLEVSEKAKDFSRSERRELRREKW. 207
72 -10.900[R] KOG1533 Predicted GTPase  ali follow..  17  25.NLGSTHWTMYGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLPNGALKYCIETLGANCNWLLQKI--EANHKKYLIIDCPGQLELYKEGELWKVIRFLEKSGVRLCAL.......................................... 165
73 -10.900[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  27  3IVRLKKLEQPVFLIVAGPNGSGKSSVYANADLE....................................................................................................................................................... 35
74 -10.800[R] KOG2383 Predicted ATPase  ali follow..  15  121.KLFSRSKPPRGLYVYGDVGTGKTMVMDMFYAYVEM---------------KRKKRVHFHGFMLDVHKRIHRLKQSLPKRKPGFMAKSYDPIAPIAEEI---SEEACLLCFDEFQVTDIADAMILKQLFELFKNGVVVVATLQRANFVPFIAVLKEYCNTVQLDSGI................. 281
75 -10.800[T] COG2766 Putative Ser protein kinase  ali follow..  11  96..AQGLEEKKQILYLLGPVGGGKSSLAERLKSLMQRVPIYVLS--VVKVWPSILEQIAIAKTEPGDENNQDISALVGKVDIRKLEHHAQNDPDAYGYSGALCRANQGIMEFVEMFKAPI-------------KVLHPLLTATQEGNYNGTEGISALPFNGIILAHSNESEWVTFRNNKNNEAF. 320

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.