current user: public

If you have questions about the server, please let us know.

Query: [V] COG1680 Beta-lactamase class C and other penicillin binding proteins, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPASLast
1 -114.000[V] COG1680 Beta-lactamase class C and other penicillin binding proteins  ali  100  1MKRSLLFSAVLCAASLTSVHAAQPITEPEFASDIVDRYADHIFYGSGATGMALVVIDGNQRVFRSYGETRPGNNVRPQLDSVVRIASLTKLMTSEMLVKLLDQGTVKLNDPLSKYAPPGARVPTYNGTPITLVNLATHTSALPREQPGGAAHRPVFVWPTREQRWKYLSTAKLKAAPGSQAAYSNLAFDLLADALANASGKPYTQLFEEQITRPLGMKDTTYTPSPDQCRRLMVAERGASPCNNTLAAIGSGGVYSTPGDMMRWMQQYLSSDFYQRSNQADRMQTLIYQRAQFTKVIGMDVPGKADALGLGWVYMAPKEGRPGIIQKTGGGGGFITYMAMIPQKNIGAFVVVTRSPLTRFKNMSDGINDLVTELSGNKPLVIPAS 385
2 -12.100[V] COG2367 Beta-lactamase class A  ali follow..  1........................MKLNRKMTMTVAEQLNAICDVQPFVRFMVRNLLTGEEIG-------------RGENEETPSGSTRKTSIMMAVLKAASEGRIDLDQPVT----------------YEKRLAEEVASGMFRYMTPG-------IVISLRDAIAGMMVLS-----------DNVCTKMV---LERLTLEEVDGYCKS-----LGMANTHHRFLIPPLALAADHPLKTVT-------------TTSAADQVLLLQTILDAQSSPEAQ--AKLGCSPQLCEWAMQTLKNQILRYGIRSRL--------PFEAMVASKSGRGKRGRMDAGIV-APSFIITTYTDEVPQVMPDG....................... 264
3 -10.100[M] COG1686 D-alanyl-D-alanine carboxypeptidase  ali follow..  15  1MNITTIAKRLSLLVLFIAPTAGWAAESMVPAPPQLA-----------AKSYVLMDGESGQVLVE-------------NGDQRLPPASLTKLMTAYIATKEIEAGRIGENDLVHAWRTGGSRMFIKVGSQVSVSDLLH----------------------------------------GIIIQSGNDASVALAEHIA--SEDAFADMMNTTA-QKLGLTNSHFMDATGL---------------------PNPDHYSSARDMAVLARAIIYGAIYAQKEFLWNNIKQPNRNLLLWRDKTVDKTGHTDEAGYCLVASAVRDGQRMIAVVFGGFRFFESRNFYKKGTELTKGLVWKGSEHEVKAGLAEDLTKLQASMVLEPQLMAPIQ 336
4 -9.360[V] COG2602 Beta-lactamase class D  ali follow..  12  1MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKDTDGTFILHDLQKDQTFVYNR------------RANQRQTPQSTFKVVNALIGL---QVKAVRDEYDVKRW-DGVKREFESWNRDHTLGSAMRESA---------------------------------------IWYYQALA--------RDIGEERMKTWLHT------------------------LSYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFV------------------GFIKT-----EHGSYVFVTNVDDSGTKAKNITVDILKKY.............. 262
5 -6.720[S] COG4283 Uncharacterized conserved protein  ali follow..  11.......................................................................................MKEYTSKVELTSAIKASYKKYIDEFEN-ISEDLKDKRFEKVDRTPAENLAYQVGWTTLL----------------KWEKDEKAGLEVHTPSENFKWNNLT-ELYKWFNKEYSHLSLAELKSSDIYKMIEMSEDELFKPHQRKWADNSTKTAVWEVCKFIHINTVAPFGTFRTKIRKWKKLLLQKN................................................................................................................. 185
6 -6.520[R] COG2823 Predicted periplasmic or secreted lipoprotein  ali follow..  1MKALSPIAVLISALLLQGCVAAGTQVDDGTLEVRVNSALSKDEQIKKEARINVTAYQGKVLLV---GQSPNAELSARAKQIAMGVDGANEVYNEIRQGQPIGLGEASNDTWITTKVRSQLLTSDLVKSKVTTENGEVFLMGLVTEREAKAAADIASRVSGVKRVTTAFTFIK..................................................................................................................................................................................................................... 191
7 -6.450[NU] COG1705 Muramidase (flagellum-specific)  ali follow..  11  9MKKKFTQILLASAIVSSTLTAVSQAGMTLSQQQFIQSIASDAQDLQKEEKILTSVTLAQAILESNWGESGLSTS----ANNLFGI----KSYEGSSVSMGTQEGKYHTQADFRKY-----------------SSLVDHAQLFINGVSNPDLYSAVIGETDYKKAAHAIQDAGYATDP----TYAEK----LISTIETYNLDDYDQ.................................................................................................................................................................................... 203
8 -6.140[S] COG3495 Uncharacterized protein conserved in bacteria  ali follow..  15  1MRRFPFARLLLLALLSSPLVHAELPEMPPADRKALEEMPDIVHDTPEAAGTTVASLDGKAIRLGGY--LENDAKGPPPPNQIVLVRYPQGLKLTDIYTPLWVSGTLKIEQVSNDLADAAYAIDKARVKVVEEADL.......................................................................................................................................................................................................................................................... 182
9 -5.910[E] COG2066 Glutaminase  ali follow..  12  50.................................................GIAVFTNQGEVI---TAG----------DAQEGFSIQSISKVLSLTLA--MGLYQPDELWSRVGK---------EPSGQAFNSLIQLEMEQGIPRNP------------------------------------FINAGAIVVCDMLQSRLSAPRQRLLEFVR-PQIAYDKVVAASEMMHSDRRSFGNFHNEVIPVLHNYFHACALKMSCVELAKTFSYLANKGVVTGETVITPTQSKQTNALLATCGLYDGAGEFAYRVGM---------------GKSGVGGGI---IAVVPGE-MTIAVWSPALDQSGNSLAGTRALELLAQ............ 309
10 -5.910[S] COG5652 Predicted integral membrane protein  ali follow..  14  1MHKRLSWLAVILWMTLIFYFSHQPATDSAKLSSGVTEFLQQLLPHVQLELEQFHTIIRKLAHFFSYFTLGL---------VFHALRQTRPNQKNSGLALLICMLYAISDEVHQLFIP---------GRSGEIRDVLIDTVG.................................................................................................................................................................................................................................................... 128

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24