current user: public

If you have questions about the server, please let us know.

Query: [R] COG1712 Predicted dinucleotide-utilizing enzyme, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MLKIGIVGCGFIGGQICRAIDGGEVSAELYALCDSSESKALELAASLKTCKPSYMKIEELIRGVDLIIESASQNAVRFIVPQALKAGCDVMILSVGALADEELRDTLFGLAKEHNCKLYFPSGAVVGIDGLNSASAAGISSVTLSTRKPPAGLMGAPYVVEHGIELEKLEKKTVLFEGPASEAVKAFPANVNVAATISLAGIGFERTRVKVIADPSLFRNVHEIIVEGEFGKFSTRVENLPSPENPKTSYLAALSAVSTLKKILNPVQIGTLast
1 -94.200[R] COG1712 Predicted dinucleotide-utilizing enzyme  ali  100  1MLKIGIVGCGFIGGQICRAIDGGEVSAELYALCDSSESKALELAASLKTCKPSYMKIEELIRGVDLIIESASQNAVRFIVPQALKAGCDVMILSVGALADEELRDTLFGLAKEHNCKLYFPSGAVVGIDGLNSASAAGISSVTLSTRKPPAGLMGAPYVVEHGIELEKLEKKTVLFEGPASEAVKAFPANVNVAATISLAGIGFERTRVKVIADPSLFRNVHEIIVEGEFGKFSTRVENLPSPENPKTSYLAALSAVSTLKKILNPVQIGT 271
2 -39.700[R] KOG2742 Predicted oxidoreductase  ali follow..  15  2LPGVGVFGTGEIANVLVPLLRE--KGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRDVDLVFIVCQPFLHAEISVKALGIGKHVVCDKPAGLHQQDALKMVRASQYYPNHPLRFLPAFTHMRRCLQEELIGSIGDVVLMDVREKYNWMCDAQMGGG--ALNLVGSVVDLVTFLLQQQAIRVIRQITAPDFCNFQMELASGTLVTVALHSHTVPASQEVLIYGSKGHLVVRGGD................................ 270
3 -39.600[R] COG0673 Predicted dehydrogenases and related proteins  ali follow..  12  4.VNIGLIGAGRIGQLHASNIIS-SPYMELKAVSDVQLDHLKGTEIERSVEIMTTNPDELFSNDIDAIFICSSTDTHAAFIKAAALAGKHIFCEKPISFHVTETKGALNIVNEAGGFNRRYDKHFRRVQECVQAGAIGAPHIIRVSSR-DPEAPPLSYVERSGGMFMDMTIHDFDMVRYLSGEVTEVSVKAANLVVDTAIITLMLENGAIAVIDNSAAYGYDQRVEVFGSLGSVSADNERKTNVQISTKDTVTL-EFATAILEDQPLRCTGE 308
4 -29.000[GQ] KOG2741 Dimeric dihydrodiol dehydrogenase  ali follow..  15  7.IRIGLLSCTNKVRKLSRAINL-SPNATISAIATTSSEEAKSFAKSNNTKLHSSYESLLEDPDVDAVYFPIPTRLHVEWATLAAIKGKHILLDKPVALNVAEFDQIVEACEVNGGTQWMHSPRTDKIKEFVDLESFGQIKSVYSCFSFAKHDIRVKPGLDGLGALGDAGWYTIQAILLVNNTALSGSVLNDAGIVLSCGALFDWEDGVNATIYCSFLANLTMEITAIGTKGSLRVH................................... 264
5 -28.000[Q] COG4693 Oxidoreductase (NAD-binding), involved in siderophore biosynthesis  ali follow..  12  9.QRVLIVGAK-FGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIP--LYTSPEQITRMPDIACIVVRSTVGTQLARHFLTRGVHVIQEHP--LHPDDISSLQTLAQEQGNTFYPHTRAGRTWLRDAQQLRRCLAKTPPVV---------------HATTSRQLLYSTLDLLLLALGVAAAVECDVVGSFSDFHCLRLFWPEGEACLLLQRYLDPDMHRLLLGWPEGHLSLEASYGPV............................. 247
6 -27.300[Q] COG4569 Acetaldehyde dehydrogenase (acetylating)  ali follow..  15  1MRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQDGLARARRMGVATTHEGVIGLMNADIDIVFDATSAGAHVKNDAALREAKPDIYCVPVVNLEANVDQLNVNMVTCGGQATIPMVAAYAEIIASIASKSAGPGTRANI............................................................................................................................... 171
7 -20.700[S] COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase  ali follow..  16  1MIPVVQLGTGNVGVHSLRALIAD-PEFELTGVWVSSDAKAGKDAAELTGVRASTDLNAVLATGPRCAVYNNRLPEALEDYRRILAAGINIVGSGPVFLIPDEIIKPLQDAARAGNSSLYVNG-ANDLLPMALAGTCESIEQIRCMEIVDYATYDSAVVMFGKPMDQIPMLLQPGVLSLAWGSVVRQLAAGVEEMYVREPAPEAFNIASGHIPKGSAAPGGSYRIEISGEPCAMDICLSSRHGDHNHAGLVATAMRIVNAIPAVVAA---G. 339
8 -19.700[E] COG4091 Predicted homoserine dehydrogenase  ali follow..  15  20.IRIGLIGAGEMGTDIVTQVAR-MQGIEVGALSARRLPNTFKAIRTAYGKIAVTDDNDLILSLIDVIIDATGPEVGAETGIAAIRNGKHLVMMNVEADVT--IGPYLKAQADKQGVIYSLGAG.................................................................................................................................................... 162
9 -16.700[E] COG1748 Saccharopine dehydrogenase and related proteins  ali follow..  13  1MKNVLIIGAGGVAQVVAHKCAQNSDVLGDIHIASRTVDKCRKIVESVREKKSLKTEVKLEAHALDIVINVGSAFVNMSVLRACMDTGVAYMCETPPWYGNYEWK--RAAECKEKGITAILGVGFDPGVVNAYARLAKD..................................................................................................................................... 165
10 -14.500[R] COG2344 AT-rich DNA-binding protein  ali follow..  13  87..DVILIGVGNLGTAFLHYNFTKNNNTKISMAFDINESKIGTEVG--GVPVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGIRLNVPEHIRIHHIDLAVELQSLV................................................................................................................................................................ 202
11 -13.900[E] COG0460 Homoserine dehydrogenase  ali follow..  12  10FLDVFVVGVGGVGGELVDQIQRQQAMMRVCGLANSKGEQWRDRMINADQAFSLENLVALVQRNNPVLVDCTSSDEIANQYADFLAAGFHVVTPNKKANTASSYYHQLRNVARHSRRKLMYETTVGAGLPVIEN-------------------------LQNLIAAGDELEKFSGILSGSLSFIFGKLDEGMTLSQATQLA------------KEKGFTEPDPRDDLSGMDVARKLLILAREAGYELELSDVDVEQALP............. 251
12 -13.300[R] COG2085 Predicted dinucleotide-binding enzymes  ali follow..  15  6.PSIAILGAGRVGSSLARSAVA--AGYEVKVAGSGAVDKIALTAEILMPGAVPSTADQ-AVKDADIVFLAVPLHKFRSVNPATLEGKIVIDTMNHWVPVNGELEEIDQDPRSTSEIIAEFFAGS................................................................................................................................................... 125
13 -13.100[S] COG5495 Uncharacterized conserved protein  ali follow..  13  12.LNIAILSTGRVGVALERA------DQVVVACSAVSHASRQWVQFRLPETSV--ASPPEVASSAELLLLAVPDCEFAGLMSGVAVTSVTIVAHTSWANGVGILAQLGKDGCI............................................................................................................................................................... 118
14 -12.900[E] KOG4777 Aspartate-semialdehyde dehydrogenase  ali follow..  13  3IKKVGILGAGTVGQRFITLLSDH-PEFKIAVLGASARSAGKPYAVATKSQMSVKACDPKEFSECDIVFSGLDADFAGEIEKSFRDANLVIVSNAKNYRREPTVPLVVPTVNTDH............................................................................................................................................................. 127
15 -12.900[E] COG0289 Dihydrodipicolinate reductase  ali follow..  22  2TLKIAIAGAGRMGCQLIQAVHSA-EGVELGAAFERKGSSAGELAGIGHLGVAVSDDLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTG---DENGKVAIKAASDKIA--IVFASNFSVGVNLV............................................................................................................................................ 133
16 -12.800[Q] COG5310 Homospermidine synthase  ali follow..  12  19..PVVMIGFGSIGRGTLPLIERKFDKSRMT-VLDPRDTDRKLLDETENNYKKLLTPLLTNGGGQGFCVNLSVDTGSVDLMRLCRKLGVLYIKADNASRTNYALREAMIKHDKPGGATVVSTCGANPGMSWFVKQALVNLATDL................................................................................................................................ 187
17 -12.800[M] COG3955 Exopolysaccharide biosynthesis protein  ali follow..  19  1MYKCLIWGVNDEYTLAYDKLLFEKGNLSIEALISKDKYAKY-------DGKEVIDKTEISNYEFDYIIIFN-KERYSDIKNEALELG........................................................................................................................................................................................ 82
18 -12.500[E] KOG0455 Homoserine dehydrogenase  ali follow..  12  5VVNVAVIGAGVVGSAFLDQLLAMKSTITYNLVLLAEAERSAALAASTTKTLPLDDLIAHLKTSPKILVDNTSSAYIAGFYTKFVENGISIATPNKKAFSSDLATWKALFSNKPTNGFVYHEATVGAGLPIISFLR........................................................................................................................................ 157
19 -12.400[E] KOG0172 Lysine-ketoglutarate reductase/saccharopine dehydrogenase  ali follow..  12  480RRKVLVLGSGYISEPVLEYLSRD-GNIEIT-VGSDMKNQIEQLGKKYNINPVSEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTAS-----ITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMET....................................................................................................................................... 615
20 -11.800[E] COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog  ali follow..  16  138..TMAIIGNGAQSEFQAIAFKALAG-VDRLRLYDIDRSASLKCAKNLGFDITICETGQEAVEGAGIITTVTADKQCATILTD-VGAGVHINAVGGDCPGKTELHRDILLRSD............................................................................................................................................................... 250
21 -11.700[EH] COG0059 Ketol-acid reductoisomerase  ali follow..  18  38.KKIVIVGCGAQGLNQGLNMRDSGLDISY-ALRPEAIAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDKQHSKVVADVMKKDSAFGYSHGFNIV............................................................................................................................................................................ 137
22 -11.700[S] COG4408 Uncharacterized protein conserved in bacteria  ali follow..  11  1MSKLLMIGTGPVAIQLANICYLK--SDYEIDMVGRASTSEKSKRLYQAYKKRLYKDVKNVKGEYETVVMACTADAYYDTLQQLLQSVKHVILISPTFGSQMIVEQFMSKFSQD.............................................................................................................................................................. 138
23 -11.500[E] COG0136 Aspartate-semialdehyde dehydrogenase  ali follow..  15  20.FKVAVAGAGNVGREMLNILEERGPADEVVPLA--SRRSQGTEVSYGDKTLKVRALDTYDFSDTDICLMSAGGSVSQEWSPKIGRQGCVVI.................................................................................................................................................................................... 109
24 -11.300[E] KOG3007 Mu-crystallin  ali follow..  12  134..SLLIIGSGKVAEKLIHAHCSVRP-IRSVRIWNHRFESAKSLASRAQIDAVPIQNLENAVKCSDIISSATLSKK---IVGSWINPGTHIDLVGGFTPHMHEADSKCIQISN............................................................................................................................................................... 248
25 -11.000[E] COG0002 Acetylglutamate semialdehyde dehydrogenase  ali follow..  15  1.MKVGIIGAGYTGGELLRLLVSH-PDVRLELATSRSLSSTHRHLTGFLDLKYENPVSEEIRERCDVVFVAVPHGTAMNYVPELLDGSTKVIDLSADYRLDTPVFENIYGIKHSAREEFVANPGCFPTGANLAAAPLAAAGLIDIAVFDSKTGISGAGISPTETSHYPNIAENIIPYK-ILQELTRLDGKLRNISFTPHVIPS-IRGILTTAHLFTKEPLSTGDVEFYRDKPFVRL-PGGVPSLTDKENNRVVVLSAIDNLVKGASNLMFG. 322
26 -10.800[I] COG2084 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases  ali follow..  17  1METIGFIGLGIMGAPMAGHLLD--AGYKVI-ASDHRSKPLADLVAK---GLKTVSGHAAVAKAADIIITMVPDTPQVA-VASGLTRGKLVI----MSSISPIETKVFAGKINELGCDY-LDAPVSGGEVGAKAASL....................................................................................................................................... 133
27 -10.700[E] KOG4354 N-acetyl-gamma-glutamyl-phosphate reductase  ali follow..  15  20.AKVVLLGAGYTGKNLIGLINTH-PYLELSHVSSRELPGYTKKEIQYVNLSTDDVKKLEEEGAVDAWVMALPNGVCKPYVDALTSANGKSVIVDLSA.............................................................................................................................................................................. 120
28 -10.600[G] COG1023 Predicted 6-phosphogluconate dehydrogenase  ali follow..  14  1.MQLGMIGLGRMGANIVRRLAK--GGHDCV-VYDHDPDAVKAMAGEDRTTVASLRELSQRLSAPRVVWVMVPAGNITTAVIETLEAG-DIVID--GGNTYYRDDLRHEKLLFKKGIHLL-VWGRERGYCLMIGGDGDAFARAE................................................................................................................................ 147
29 -10.500[E] KOG2380 Prephenate dehydrogenase (NADP+)  ali follow..  11  53.LRIAIIGFGNYGQFLAETLISQ-------ILFAHSRSDHSSAARRLGVS-YFTDLHDLCERHPDVVLLCTSENILKTLPFQRLRRNT--LFVDVLSVKEFAKTLLLQYLPEDFD---ILCTHPMFGPQSVSSNHGWRGLRFVYDKVRIGEERLRVSRCESFLEIFVREGCEMVEMSVTDHDKFAAESQFITHTLGRLLGMLKLISTP---INTKGYEALLDLANICGDSFDLYYGL----FVYNNNSLEVL--RIDLAFEALRKELF... 305
30 -10.400[E] COG0287 Prephenate dehydrogenase  ali follow..  17  7FERIALIGIGLIGSSIARDVRELGLARHVVIS-TRSEDTLKR-AEELALGTDYTVSAAEAVKDADLVIVSVPVGASESVAQQIAPYLKPSAIVTDVGSTKASVIAQMAPHMPEN............................................................................................................................................................. 118
31 -10.200[E] COG0345 Pyrroline-5-carboxylate reductase  ali follow..  18  4.QKIGFIGAGKMGSALMQGTKAGIVTPENIGASDVYEPFLKDLQAKLGIR--VSTDNAVIVRESDILILAVKPQTLSSVLSNLKNTSEKLVISIAAGVPLSTYEDALLEGTR............................................................................................................................................................... 115
32 -10.000[I] KOG2304 3-hydroxyacyl-CoA dehydrogenase  ali follow..  10  22INNVTIIGAGLMGSGIAQVSANAKLNVTVVDSNQDDAAAQTALVSSVLDRIKMSTNVSDSVKDADLVIEAIVENIDIK-EVEVAAKPTTLITTNTSSLRLADIGLNLKDKSRFGGLHFFNPVPMMKLLEVVRHTETSD..................................................................................................................................... 186
33 -9.580[E] KOG3124 Pyrroline-5-carboxylate reductase  ali follow..  1.MSVGFIGAGQLAYALARGFTAALSAHKIIASSPEMNLPTVSALRKMGVN--LTRSNKETVKHSDVLFLAVKPHIIPFILDEIGAQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTN..................................................................................................................................................... 123
34 -9.520[S] COG4378 Uncharacterized protein conserved in bacteria  ali follow..  17  1MSSIMIVG-ADHLGTIPKKLNEI--GFSEIMHVTGRKVKAV---------------KKEIPSHVDLILVLTNHNLTSVLKKRASEQDIPICYAKRSWCSIYKVIGQCDAYCPKRN............................................................................................................................................................ 100
35 -9.450[R] COG4106 Trans-aconitate methyltransferase  ali follow..  13  33..NGYDLGCGP-GN-STELLTDRYGVNVITGI-DSDDDMLEKAADRLPNTNFGKADLATWAQKADLLYAVPDHLAVLSQLMDQLESGGVLAVQMPDNLQEPTHIAMHETADGG.............................................................................................................................................................. 148
36 -9.360[R] COG4015 Predicted dinucleotide-utilizing enzyme of the ThiF/HesA family  ali follow..  13  20..EVTLVGAGRLGLRTALNLMQHRGGPERINVIDGQRVSADDLIFRLMGATPGEYKVKFIESGFSRTVRGIPEYIDRDNLHLLRGDVVCVEIA---GGDTLPVTAEIIKYAQKRGSATISTMGV................................................................................................................................................... 143
37 -9.330[H] COG0373 Glutamyl-tRNA reductase  ali follow..  17  182..TVLLVGAGETIELVAKHLAG--HHCKRMIVANRTRERALSLAQQFGADVIALNEIPDYLAQADIVISSTASPIGKGMVESALKARRH----QPMLLVDIAVPRDIEPQVGK.............................................................................................................................................................. 289
38 -9.300[E] COG0169 Shikimate 5-dehydrogenase  ali follow..  15  125..TILLIGAGGAARGVLKPLLD--QQPASITVTNRTFAKAEQLAELVAAYGEVKQAFEQLKQSYDVIINSTSASLDGEIDPVIFSSRSVCMMYGKGYTVFNQWARQHGCAQAIDGLGMLVGQAAES................................................................................................................................................. 252
39 -9.280[I] COG1250 3-hydroxyacyl-CoA dehydrogenase  ali follow..  11  2IKTVGIIGAGQMGCGIAHVSAAAGYKVQLYDIAADRIEAGLATINGN-LSLIKGSGDINDLAQADLVIEAVTEDETVKRKICPVMRPDAILATNTSSLSITRLASATDRPERFMGIHFMNPVPVMKLVELVRGIATEE..................................................................................................................................... 160
40 -9.250[R] COG1832 Predicted CoA-binding protein  ali follow..  13  18..RIAVVGLSRTSHMVSKAMQDA--GYEIIPV----NPTIDEALGV-----KAVSSLKEIDGPIDIVNVFRRSEQLPGVAEEFLETDAPVFWAQQGLVNEE-----AYQMLKEKGRTV......................................................................................................................................................... 121
41 -9.250[H] COG1893 Ketopantoate reductase  ali follow..  12  4.PRVAVIGSGSIGLLLYAYLKLANWPALLV---TNRPEQADHLNKE--ISVTATPLSSFSAEEAEVGFITVKSFAVKALLPQLFQNGMTAKRESDVRVQDSKNFDPMWACLHNAGLKAQKVTNWQDKMKLIANAAINPLTGLFRVKN-----------------ALIENQLFSLLLKELVKEACVTLGREREVDEHLAYTRAICDKTANNLSSMYMDLTHHRRTEIESITGYL-IKEAAKKGIEIPNTSFV--YHAVMGMDEEGRKVRMG. 308
42 -9.240[R] COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase  ali follow..  12  4.MKVAVYGAGNQKLYVDQAIEFAEAGHDVVL-AEPARDMLDDAHWKEDAGVTVTDNDAEAASEAEIAVLFTPGKKTFEIAKNILPEGA--VIANTCTVSPVVLYYVLERELRRDRKDLGIASMH................................................................................................................................................... 147
43 -9.200[I] COG0743 1-deoxy-D-xylulose 5-phosphate reductoisomerase  ali follow..  11  1MKQLTILGSGSIGNSTLSVVRANPELFKVTALAGRNVREMAQQCLEFSPRYAAMSDEHSAKSDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCG--KLFMDEVKRSRAQLLIDSEHNAIFQSLPERIQRQLGYSRIILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRSVDSATMMNKGLEYIEARWLFNASAEQIEVVL-----HPQSVIHSMVRYHDGSILAQM.................................. 271
44 -9.130[S] KOG2733 Uncharacterized membrane protein  ali follow..  13  6.LDVIIFGAGFTGKYTVFEAVTVLRGLRW-GIAGRNREKLEAVLKEMGADVNDQASLLEMAKKCRIVVNTAGPYRFENVVKCCIESGTHHVDVSGEPQYMETMQLRYDQLAREKGVYVVSACGF................................................................................................................................................... 144
45 -9.070[S] COG3268 Uncharacterized conserved protein  ali follow..  16  8.FDIVLYGAGFSGKLTAEHLALSESTARI-ALAGRSSERLRNVRALLGADASQPSTLEAMAGRAQVVLTTVGPYTRLPLVAACARTGTDYADLTGELMFCRNSIDLHHKQAAATGARIILACGF................................................................................................................................................... 142
46 -9.040[R] COG2910 Putative NADH-flavin reductase  ali follow..  19  1MAKIALIGAGNAGSRILKELSD--RGHQVTAIANPEKIAALPNVVAKKGDVFDQAALSELLKGHDAVISSVHASDPATLIEAVRASGVQRYL................................................................................................................................................................................... 94
47 -9.010[R] COG1064 Zn-dependent alcohol dehydrogenases  ali follow..  14  176..KVAIVGLGGLGHMGVKLAHAMGAEVTVLSQTLSKKEDGLKLGADHYYATKDPETFTKLAGSFDLIICTVAAEIDWNAYLNLLKDGELVLVGIPENPVPVHAFSLVPARRSISGSMIGSIKETQEMLDFCGEHGI....................................................................................................................................... 310

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.