current user: public

If you have questions about the server, please let us know.

Query: [T] COG1734 DnaK suppressor protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MQEGQKRKTSSLSILAIAGVEPYQEKPGEEYMNAAQLSHFKLILEAWRNQLRDEVDRTVSHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAGLast
1 -70.000[T] COG1734 DnaK suppressor protein  ali  100  1MQEGQKRKTSSLSILAIAGVEPYQEKPGEEYMNAAQLSHFKLILEAWRNQLRDEVDRTVSHMQDEAANFPDPVDRAAQEEEFSLELRNRDRERKLIKKIEKTLKKVEDDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG 151
2 -8.210[DV] KOG4537 Zn-ribbon-containing protein implicated in mitosis  ali follow..  16  8.............................................................................RDDDAASIRLRDSFRDEVSKRMGELLLK------GQCPTCSGIL----MEDRALVRRCVTCELFREKSSV.... 73
3 -8.070[U] KOG3838 Mannose lectin ERGIC-53, involved in glycoprotein traffic  ali follow..  11  346.RQETTLSLVSRNAGQALPPPAAGGVPQQQLPVGAVSRSDVDLLLTNQNMLLSSIREIRQLVGDINVRTDNIQTNQKHAPTAQIQ-STGYDVQTLIAEMRDGMNQVKQGITHVGQRLAAPQGAAQVANCPTGN-CVG-KNRSEAQAKKF.. 511
4 -7.400[TDK] COG5041 Casein kinase II, beta subunit  ali follow..  12  57.................................SQEVPHYRKALDLILDLEAMSDEEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHLQAMAEKFDHKEFGTCPRCNGPCGLSDTVGKHTVRYCPSCQDLYLPQSSRFL. 199
5 -7.270[S] COG3908 Uncharacterized protein conserved in bacteria  ali follow..  13  9.........................................................................................GGKEARIRYLDGDFQVTSPGSFVRCAVTGENIPLDELEPYVNATASLRREIEVHPELRKRS. 77
6 -7.160[R] COG1645 Uncharacterized Zn-finger containing protein  ali follow..  18  2.............................................................................KNRAKRKVRHMDSDRDKKVKRIARFLEL------GHCKVCGAPKFRYQ------TVICPICDVREEGEET.... 66
7 -7.070[A] KOG4394 RNase P subunit that is not also a subunit of RNase MRP, involved in pre-tRNA processing  ali follow..  30...............................................NQDHFHRLNYLYQISAYQTRARQKARTDAHTPLARNYIKSMDLISKKTKTSLLPTIKR-------ICKKCHRLL-KLEITSDGALSVMCGCGTVKR........ 122
8 -7.060[TDK] KOG3092 Casein kinase II, beta subunit  ali follow..  14  80..DSEESEVSGSDGEDTSWISWFCNLRGNEFFCEVDDDYIQDDLSHQVPYYDYALDLILDVESSHGEMFTEEQNELIESAAEMLYGMIHARFILTSKGLASMLDKYKNYDFGRCPRCCGPVGQSDIPRASTVKYCPKCEDVYYPRSKYQG. 239
9 -6.910[C] COG2191 Formylmethanofuran dehydrogenase subunit E  ali follow..  16  120..........................................................NKVIVRREGSEEDAKRLSEFWEETGWKMLEIPEEEFKVEFVEQPIERAPIFENKRCEKCGELAMATRVK----DGLCLRCAGS.......... 199
10 -6.900[R] KOG2997 F-box protein FBX9  ali follow..  15  1MAEAEEDCHSDTVRADDDEENESPAETDLQ----AQLQMF-------RAQWMFELAPGVSSSNLENRPCRAARGSLQKTSADTKGKQEQAKEEKARELFLKAVEEEQNGALY------EAIKFYRMQLVPDIEFKITYTRSPDGDGVG... 133

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.