current user: public

If you have questions about the server, please let us know.

Query: [H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
# Score Template Links and tools%idFirst MNIFGITGWKNSGKTTLTEKLVAELVRRGWKVSTVKHAHHDFDIDKPGADSFRHRQAGATEVAIVSGNRWALMHELRGEDEPPLESILSRLAPCDIVLVEGYKRESHRKIETRRLEAKDRTPLSAGDPNIVAIAADFAVTDKSLPAFDLDDVKSIVDFIERTTGLVALast
1 -80.600[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali  100  1MNIFGITGWKNSGKTTLTEKLVAELVRRGWKVSTVKHAHHDFDIDKPGADSFRHRQAGATEVAIVSGNRWALMHELRGEDEPPLESILSRLAPCDIVLVEGYKRESHRKIETRRLEAKDRTPLSAGDPNIVAIAADFAVTDKSLPAFDLDDVKSIVDFIERTTGLVA 167
2 -17.000[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  16  6..IIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITND-------YTKEDARILLNTSVLPADRIAGVETTAIREDASMNFAAIEEMCDKHPDLQLLFLE................................................................... 102
3 -13.800[C] COG3954 Phosphoribulokinase  ali follow..  7..VIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEGDSFAIRKARDAGRHISYFGPEANDFSLLEHTFIEYGQTGKGQSRKTFTPWQPLPEPTDVLFYEGLHGGVVTPQHDVARHVDLLVGVVPIVN....................................... 158
4 -13.400[R] COG4240 Predicted kinase  ali follow..  16  90..IQGILGSQGTGKTTMSLVIQLILQHLGYRTLSLSLDDLYKTYSDPGTHDIDLGLNVLEQIRQGKSPVIVPRFDKSAHAGAGDRTKPDVITGVDILIFEGW................................................................. 205
5 -13.200[E] COG4917 Ethanolamine utilization protein  ali follow..  18  1MKRIAFVGSVGAGKTTLFNALQ------GNYTLARKTQAVEFNIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAV-------ISKTDMPDADVAATRKLLLETGFEEPMFE--------LNSHDPQSVQQLVDYLAS...... 144
6 -13.100[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  17  7..IVGVSGASCSGKSTLCQLLHAIFE----GSSLVHEDDFSLNLDAFLENLHYIRDHGVLPTHLRNRENKNVAPEAYADIIKEFKAPAIPTLEQHLVFVDGFMMYVNEDL......................................................... 133
7 -12.800[R] KOG2878 Predicted kinase  ali follow..  20  27..ILGISGPQGSGKSTLASALDTELTRKNESVVKFSLDDFYLTLAKNNPNNPLVQHRGLAGTEVSIPFYDKSKFGGYGDRGDESQWKKANPKTTTYVIFEGW................................................................. 151
8 -12.600[F] COG1618 Predicted nucleotide kinase  ali follow..  12  10MLRIAVTGSPGVGKSTVVAKTAEKLAEKGIRTAEIRKEGHREGFSIRDLATGKTGILSHVKGSGPRLGKYHVNLDD----ERIGANAVRNALACDLVVIDGPMELISQSFAVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFL... 180
9 -12.500[H] KOG2743 Cobalamin synthesis protein  ali follow..  12  42IPVTIITGYLGAGKTTLLNYILT--EQHSKRVAVILNESGEGSALEKSLAVSQGGELYEEWLELRNG---CLCCSVKDNGLRAIENLMQKKGKFDDILLEGLAD---PGAVASMFWVDAELGSDIYLDGIITIVDSKYGLKH----LTEEKPDGLINEATRQVALA. 197
10 -12.300[H] COG0132 Dethiobiotin synthetase  ali follow..  14  2LTRLFVTG-TAVGKTVVSRALLQALSQNGRTAVGYKPVATESKETSEGQDALILQASSSIELNYLQGDVIHACTDTLINYEKMTEGLQCLSAKADTVIVEGCGGWKVM---MNDQRFYSDWVVQEQLP--VILVVGIKLGCINHALLTAQAIINLLGWVANRIN... 175
11 -12.100[H] COG1072 Panthothenate kinase  ali follow..  19  82..IISIAGSVAVGKSTTARVLQALLSRWGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEG.................................................................. 192
12 -12.100[F] COG0572 Uridine kinase  ali follow..  17  10..IIGIAGASASGKSLIASTLYRELREQDQHIGVIPEDGYYKDQSHLSMEKTNYDHPSAMDHNLLLEHLQALKAGKPVELPLTRKKETVHLEPKKVIILEGILLLTDIRL......................................................... 128
13 -12.000[R] COG0523 Putative GTPases (G3E family)  ali follow..  15  4IAVTLLTGFLGAGKTTLLRHILN--EQHGFKIAVIENEFGEVSVDDDRATQIKTLTNGCICCTRSNELEDALLDLLDSRDRGD--------IAFDRLVIEGMAD---PGPIIQTFFSHDVLCERYLLDGVIALVDAVHANEQMNQFTIAQSQIGYADRIL....... 156
14 -11.900[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  16  129..LVGLAGPPGAGKSTVANEVVRRVNKLW-VAIVLPMDGFHLYLDAMEDPKEAHARRGAPWTF-LKNEGSVYVPSFDHGVGDPVEDDIFVSLQHKVVIVEGLEEGSWKDI......................................................... 267
15 -11.700[R] KOG2486 Predicted GTPase  ali follow..  14  135LPEFALVGRSNVGKSSLLNSLVRRTSKKPGKTQCINHFRINDKVDLPG---------GYASAPHELKQDWNKFTKDYFLNRSTLVSVFLLVKPIDLEYASWLGQNQVPKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLRN 313
16 -11.500[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  18  1MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISE------------NEAVPKAGFGKNSHTGDSQKEKVVRSD------LKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKV................................................. 100
17 -11.400[N] COG1419 Flagellar GTP-binding protein  ali follow..  16  173.AKVLFVGTTGVGKTTSLAKLAARFKDEKKRVAILT------------LDTYR---IAAAEQLKIYADIMDIPMKIAYTPK-EAEYEMMALKDYDIVLVDGRSHQNDLQMSELR-----ALSEAVKPNITFLVLSMNYKLDDMKRIVERFSAVKPTHIILTKMD... 317
18 -11.300[M] COG1663 Tetraacyldisaccharide-1-P 4`-kinase  ali follow..  13  56VPVVVVIHAGGTGKTPIVAALVSGLQEKGVKVGIISRGYGRKSKAV--NAESRAEDAGDEPLLLFRKTGAPTAVG--SSRAEAGRALLAAHPDIGLIVADGLQHYALRR.......................................................... 166
19 -11.200[R] COG2403 Predicted GTPase  ali follow..  17  137KPSLKILGTKRIGKTAVSAYAARLIHERQYNPCVVAMGRGG-RIEITPEFLMEQSDKGVHAASDHWEDALMSMVGDVFITNMKRGAETANRLDADFVILEGAAIPPVKSIVLVGANQPLINIKNFFGPFRIGLADLVIVTMCEEPMAGDEKVREIVDFIES...... 325
20 -10.800[F] COG1435 Thymidine kinase  ali follow..  14  3.QLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTS-----SLDTRAGVGTVASRIGMKAEAVAIDEEMSVF-----------DYVNSLPAKPFCVLID--------EAQFLNKKHVYDFARVVDELNVPVMAFGLKNDFRNELFEGSKYLLLLADKIEE...... 138
21 -10.700[H] COG1797 Cobyrinic acid a,c-diamide synthase  ali follow..  15  2QPRLVIAGHSGVGKTTVTLGLMAAFVEKGNIVQGFK-----------GPDSYHRAVTKRASRNLDS-----------VSEDVVNDIFIEGCNGADLSIIEGVMG--YDGKASTSDKGSTADISLLLQAPVLLVVDISGMARSAAAVVQLNEKVKIAGVILNGAG... 154
22 -10.600[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  17  33.AKVMIIGDVDTGKTTLTIYLANELLSRGFRVAIIDSDIGQKGILPPATISLAFVDSHFTSLDDLKAFSHYFIGTITPNQYFGEKLSELAMKFSDVVLIDGMIYGSGVELKR-------MKIEAVKPNLILALERNNELAP.......................... 173
23 -10.600[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  12  24.KLILLNGGSSAGKTSLALAFQDLAAECWMHIGIVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRVWMVG-----HVSDEEGARRELERGDRHPGWNRGSARAAHADAEYDFELDTTATP-VHELARELHESYQ... 208
24 -10.300[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  18  20...ILLLGLDNAGKTTLLKQLSHITPTQGFNIKSVQSQGFKLNVDIGGQRKIRFENTDILIYVIDSADRKRF---EETGQELAELLEEEKLSCVPVLIFAN.................................................................. 126
25 -10.300[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  17  114.PRVIIVGDIDSGKSTLAKMLLNWAVKDGWKPTFVDLNVGQSSITIPGTIAAAPIKMGLTNPSVNLRLYRTLVEELARELKEEFSANAESRASGMVIDTMGFIVREGYALLL-------HAIRTFNASLVIVVGQEEKLVY.......................... 264
26 -10.300[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  11  23...ILFLGLDNAGKTTLLHMLVQHQPTQHPTSEELSIGKIKFKADLGGHQIARYAKVDAVVYLVDAYDKERFAESKRELDALLSDEALATVP---LILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN... 193
27 -10.200[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  17  35...YGLCGRNGAGKSTLMRAIANGQDKDTLRTCFVEHKLQGEEGDLDLVSSREEIAAALESVGFDEERRAQTVGSLSGGWKMKLELARAMLQKADILLLD----EPTNHLDVSNVKWLEEYLLEHTDITSLIVSHDSGFLDTVCTDIIHYENKKLAYY......... 201
28 -10.200[F] COG4088 Predicted nucleotide kinase  ali follow..  12  1MPLIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDYRVIIINDESLNIEKETYRESK--------------NEKAARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLYCESKS................................................. 104
29 -10.200[S] COG3367 Uncharacterized conserved protein  ali follow..  15  157IKVVGVFGTDVVGKRTTAVQLWERALEKGIKAGFL--------------------ATGQTGILIGADAGYVIDAVPADFVSGVVEKAVLKLTGKEIVFVEGLLYGSNPDVVFLVHDPSRRLIETLSNAKVIGGVSLNGGFETDLPVYDPDDLDEMLERAMVW..... 338
30 -10.100[P] COG1348 Nitrogenase subunit NifH (ATPase)  ali follow..  15  1MRQVAIYGKGGIGKSTTTQNLTSGLAELGKKIMVV-------GCDPKADST-EGEDVDLDTIMKTGFGNIKCVESGGPTSINMLEQLGAYEDELDYVFYDVLGDVVCGGFAMPIREGKAKEIYIVASGEMMAMYA................................ 157
31 -10.100[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  13  58...VLLSGLSGSGKTVLFYQLRGAVTSMEPNEGTFVLHNENNTIDVPGHSRLILPRAAAVVFVVDALEFLPNIRAASEYLYDILTNASVIKNKTPVLLCTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIEGEVFSFSHCHNKVTVA........ 238
32 -10.100[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  20  24...ILMLGLDAAGKTTILYKLVVTIPTVGFNVETVTYKNIKFNVDVGGQDKIRFTGTKGLIFVVDSADSNRI---SEARQELHRIISDREMRDCLLLVLAN.................................................................. 130
33 -10.100[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  22  20...ILMVGLDAAGKTTILYKLVTTIPTIGFNVETVEYKNISFTVDVGGQDKIRFQNTQGLIFVVDSNDRDRV---VEARDELHRMLNEDELRDAVLLVFAN.................................................................. 126
34 -10.000[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  24  20...ILILGLDGAGKTTILYRLVTTIPTIGFNVEQVTYKNLKFQVDLGGQTSIRYSNTDAIIYVVDSADRDRI---GISKDELLYMLREEELAGAILVVLAN.................................................................. 126
35 -9.980[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  10  3LPNILLTGTPGVGKTTLGKELASKSGLKYINVGLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTD-VLYERLETRGYNEKKLTDNIQC-------EIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWI. 163
36 -9.950[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  21  19...LLMLGLDNAGKTTILKKFDTISPTLGFNIKTLEHRGFKLNIDVGGQKSLRFESTDGLIWVVDSADRQRM---QDCQRELQSLLVEERLAGATLLIFAN.................................................................. 125
37 -9.870[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  11  23...LTLVGLQFSGKTTFVNVI-DMIPTVGFNMRKITRGNVTIKVDIGGQPRFRCRGVNAIVYMVDAADLDKLEASRNELHS----------------LLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLIQDREICCYSISCKEKDNIDITLQWLIQHSK... 182
38 -9.860[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  20  21...ILILGLDGAGKTTILYRLVTTKPTIGFNVETLSYKNLKLNVDLGGQTSIRYADTAAVIFVVDSTDKDRM---STASKELHLMLQEEELQDAALLVFAN.................................................................. 127
39 -9.800[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  17  8VRTVAILGGESSGKSTLVNKLANIFNTT---------------AWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCK............................................................... 97
40 -9.740[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  18  56..RLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVI-------AVDPSSPDKTRMNDLARAEAAFIRPVPSS-------SQRARELMLLCEAAGYDVVIVEGVGQS---ETEVARMVDCFISLQIAGGGDDLQGIKKGLMEVADLIVINKDDGDNHTNVAIARHMYES 219
41 -9.680[F] COG2019 Archaeal adenylate kinase  ali follow..  15  2..RSVITGVAGVGKTTVLDIVARESGIPVVNYGTLMFEVAKRRGLVENRDQIRKLSRETQVDLQKL--------------------AGEEIGKMENAIVDTH................................................................. 81
42 -9.640[R] COG0857 BioD-like N-terminal domain of phosphotransacetylase  ali follow..  13  3.RIIMLIP-TSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRAGGDAPDQTTTIVRANAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTKDAEVVLVEGLVPTRKHQFA----QSLNYEIAKTLNAEIVFVMSQGTDTPEQLSSFGGAKNTNITGVIINKLN... 175
43 -9.640[R] COG3596 Predicted GTPase  ali follow..  16  39.PVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPG--------------VGESGVRDTEYAALYREQLPRLDLILIKADDRALATDEHFYR-----QVIGEAYRHKMLFVISQSDKAE.......................... 161
44 -9.610[R] KOG2203 GTP-binding protein  ali follow..  16  40YAVVAIMGPQSSGKSTLLNHLFRSQTTKGIWMARCVGIEPFT-MDLEGTDG---------------------RERGEDDTTFEKQSALFAIAVADIVLINGREQAANKPLLKTVFQVMLRLFSPRKTTLLFVIRDKTKTPIELLERALREDIQKIWDSVRK...... 198
45 -9.600[D] COG3640 CO dehydrogenase maturation factor  ali follow..  24  6MPKLIISGRGGSGKSTLVTLIAHTLKEQKKRVLVVDSDESNIGLS.......................................................................................................................... 50
46 -9.450[R] COG1163 Predicted GTPase  ali follow..  16  68...VGFVGFPSVGKSTLLSKLTGTFTTLVTVPGVIRYKGAKIQMDLPGDGAKDGRGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEK--SITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEA...... 237
47 -9.430[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  21  20...ILILGLDNAGKTTFLETLKKEYSLAGQNVATIPVDSKQI--DVGGQESLRYSLCHGIIFIVDSSDRERL---DECSTTLQSVVMDEEIEGVPILMLAN.................................................................. 133
48 -9.360[U] COG0552 Signal recognition particle GTPase  ali follow..  17  122..VILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLA------------AGDTFR---AGAIEQLEVWGERTGVPVIKQTAGSDPAAVIYDAVHNADVLICDGRLQNKVNLMKELEKVKRVIEREVPEAPHEVLLALDATTGQNAMAQAKFSKATNVTGIALTKLD... 276
49 -9.340[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  11  168TRTVLICGYPNVGKSSFMNKVTRAFTTKSLFVGHTDYKYLRYQVDTPGILDRPFEDRNSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSLFMNKPLVIVCNKTDLMPMEN.................................................. 298
50 -9.250[R] KOG1533 Predicted GTPase  ali follow..  11  38.....VIGAPGAGKSTFCAGLTDIFSQTKRPFLTINTMAYAPDVNITENDVMDRLGLGPNGALKYCIETLG--------ANCNWLLQKIEANHKKYLIIDG-------QLELY--------KSEGELWKVIRFLEKSGVRLCALHLADSLYCSDPSKFISVALSTLA 188
51 -9.220[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  16  67...IGFVGFPSVGKSTLLSNLAGVFTTLTTVPGVIRYKGAKIQLDLPGEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDK....................................................... 186
52 -9.110[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  18  46.....VVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNSLPFGANIDIRDKEVMKQYNLGPNGGILTSLNLFA------TKFDEVVSVIEKRADQLDYVLVDG-------QIEIFTWSASGAIITEAFASTFPTVV---------TYVVDTPRSSSPITFMSNMLYACS 197
53 -9.110[R] COG0218 Predicted GTPase  ali follow..  15  25LPEIALAGRSNVGKSSFINTMTSGKPGKTQLLNFFNIDDKMRFVDVPG---------GYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVSADDVQMYEFLKYYEIPVIIVATK.................................................... 145
54 -9.090[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  14  5..VLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDRHGLNSDLGFSDADRVENIRRVGEVARLMADAGLITPVSFISPFREERDQVRARLPEGEFIEI.................................................................... 105
55 -9.040[K] KOG1534 Putative transcription factor FET5  ali follow..  12  8.....VCGVASSGKSTFCGALMSYMKSVGRSCHLVNNFEWEPTVDIRDDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIGDYDE--------DYLIFDG-------QIELYTHVPILPAL-------IRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMS 159

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.