current user: public

If you have questions about the server, please let us know.

Query: [S] COG1937 Uncharacterized protein conserved in bacteria, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MKHDQPIVPRKDEETKLLQNRLRRIEGQIRGIAQMVEDDRYCTDILVQISAANKALKNVGLQVLEHHTAHCVVDAAKNGEDDVMEDLLKAIRQFSKTLast
1 -51.800[S] COG1937 Uncharacterized protein conserved in bacteria  ali  100  1MKHDQPIVPRKDEETKLLQNRLRRIEGQIRGIAQMVEDDRYCTDILVQISAANKALKNVGLQVLEHHTAHCVVDAAKNGEDDVMEDLLKAIRQFSKT 97
2 -6.120[S] COG5369 Uncharacterized conserved protein  ali follow..  11  21............KDEHELLRYIVPFKNWVIGLLNLFSLENLSMNEKYQVFVVLNSLQDPFVQFLRHEDLLSVMQMISKRDSTPYGMLNITLKVFNTM 125
3 -6.120[R] KOG1293 Proteins containing armadillo/beta-catenin-like repeat  ali follow..  11  21............KDEHELLRYIVPFKNWVIGLLNLFSLENLSMNEKYQVFVVLNSLQDPFVQFLRHEDLLSVMQMISKRDSTPYGMLNITLKVFNTM 125
4 -5.780[K] COG5221 Dopey and related predicted leucine zipper transcription factors  ali follow..  1MSLPLKPLTIDSNNKQL--SKQKKFRANVERALERFDSVTEWADYIASLGTLLKALQS-SPYQVSRRLTSSLSPALPAGVHQKTLEVYTYIFEHIGL 108
5 -5.540[K] COG1510 Predicted transcriptional regulators  ali follow..  10  29.....................MPSTVGRVLGIIYMNRKPMTLSELSEATGMSKTRMSQVVREMIDANI............................. 75
6 -5.520[U] KOG3229 Vacuolar sorting protein VPS24  ali follow..  10  71...............RKAINRIYTSKAHLNSIQMQMKNQLSTLRVAGSLQKSTEVLQAMQSLVRYPELAGIMRD---SKEMMKAGIIEEMLDETMDS 150
7 -5.470[S] COG5660 Predicted integral membrane protein  ali follow..  16  3.........................................CEVAREALSALDGEREAVPSVRVDEHLGECSACRAWFDQVADQARDLRQL...... 53
8 -5.460[O] COG5536 Protein prenyltransferase, alpha subunit  ali follow..  13  116.............HRQKILSLTKNYERELEFTKKMFEIDSK---ILQNFNDYSQELKLTNELLEKDNHRFYVLFETSKVVSWSLEEELNYLKDKILF 213
9 -5.430[S] COG0718 Uncharacterized protein conserved in bacteria  ali follow..  12  12............KQAQQMQEKMQQMQEEVAKLEVTGESGAGLVKVCRRVEIDPSLLVEDDKEMLEDLIAAALNDAARRIDETQKEKMASVS...... 97
10 -5.360[O] KOG4098 Molecular chaperone Prefoldin, subunit 2  ali follow..  10  20...............QQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCERTVKEVL--PQLVENKDFIAKTIQMVTNDLSK 99

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24