current user: public

If you have questions about the server, please let us know.

Query: [Q] COG2015 Alkyl sulfatase and related hydrolases, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660
# Score Template Links and tools%idFirst MKTVFKPTLLAVLVAASAPVLAHSLIADTKAPSPTTKAFAAEQRNTLPFADQEDFKLVEKGLIAQQKDLEIKDANGKVVWELGNYRFLLDGLDYDSIHPSLQRQAQLNMHHGLYKVTDRIYQVRGYDLANITFVKGDTGWIVFDPLTVPATAKAALDFVNQELGERPVKAVVYSHAHADHFGGVKGIVSQEQVDRGEVPIIAPKGFLNHAVAENVLAGNAMSRRTTYQYGNVLPKGATGQVDAAIGKNVAQGEVSLIAPTKVISEQTETVVIDGVTMEFQNTPGTESPAEMNTYFPQFKALWMAENTVGGLHNVYTLRGAEVRDAKAWSKYINESIHMYAKEADVMFASHTWPRWGNDNINHFLRKQRDMYGYIHDQALRLANHGVTINEIQDEFHVPDVLAHEWYNRGYHGSYHRNAKAVINKYLGYFDMNPATLRPLAPTDAAPKYVAAMGGMDNVIKLGKEAFDKGEFRWCAEIVDKAVFAEPSNKQARYLQADCLEQLGYQSESAGERNTYLMGAYELRNGVPKVSATKTAGADTVVAMDTELFLDYLGVRLNGDKAAGIDYTINFVLPDVNEKFLVELENAHLNNLKGIQSENPDMTLTLNRAQLNQVLMGKTTIQQLAKEGKAKIEGNAQALTDIAGMLDNFEFWFNIIEPKTKLast
1 -193.000[Q] COG2015 Alkyl sulfatase and related hydrolases  ali  100  1MKTVFKPTLLAVLVAASAPVLAHSLIADTKAPSPTTKAFAAEQRNTLPFADQEDFKLVEKGLIAQQKDLEIKDANGKVVWELGNYRFLLDGLDYDSIHPSLQRQAQLNMHHGLYKVTDRIYQVRGYDLANITFVKGDTGWIVFDPLTVPATAKAALDFVNQELGERPVKAVVYSHAHADHFGGVKGIVSQEQVDRGEVPIIAPKGFLNHAVAENVLAGNAMSRRTTYQYGNVLPKGATGQVDAAIGKNVAQGEVSLIAPTKVISEQTETVVIDGVTMEFQNTPGTESPAEMNTYFPQFKALWMAENTVGGLHNVYTLRGAEVRDAKAWSKYINESIHMYAKEADVMFASHTWPRWGNDNINHFLRKQRDMYGYIHDQALRLANHGVTINEIQDEFHVPDVLAHEWYNRGYHGSYHRNAKAVINKYLGYFDMNPATLRPLAPTDAAPKYVAAMGGMDNVIKLGKEAFDKGEFRWCAEIVDKAVFAEPSNKQARYLQADCLEQLGYQSESAGERNTYLMGAYELRNGVPKVSATKTAGADTVVAMDTELFLDYLGVRLNGDKAAGIDYTINFVLPDVNEKFLVELENAHLNNLKGIQSENPDMTLTLNRAQLNQVLMGKTTIQQLAKEGKAKIEGNAQALTDIAGMLDNFEFWFNIIEPKTK 660
2 -31.500[R] KOG0813 Glyoxylase  ali follow..  12  1..........................................................................................................MALIPAVTRLTSSVIRILGLQGTNTYLLGSGSRRILIDTGDEDVPQYIAHLGDVLQQEKASIDTILLTHWHHDHVGGVKSIVGTKLA-----EKDCRVFKFGRTDAPDVCPEIPTDI------------------------------------KLHPLAHNQEFTTEGANVRVVHTPG-HTTDHVVLAMNE-GTLFSGDCILGEGTAVFE----------DLFEYMKSLEKILDIKPQRIFPGHGNVIEEIGKIEYYINHRNQREQQILQFFVQRPNENLQAMDVVKVV---------------------------------YKETPENLWPAAAYNVNHHLSKLEK------GKLRVSKSADEEFYVYQPTSAL................................................................................................................................................................................... 292
3 -25.100[I] KOG4170 2-enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase/Peroxisomal 3-ketoacyl-CoA-thiolase, sterol-binding domain and related enzymes  ali follow..  16  1........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSEDGGTWFLDLKSKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL........ 133
4 -21.500[C] COG0426 Uncharacterized flavoproteins  ali follow..  3............................................................................................SMSTTGNAHTENVQHRLTVETVEIAPNTTAIRCLD-YNSYLIRGEQT-VLVDTS-HQKFRQLYLETLKGLINPKAIDYIIVSHTEPDHSGLVEDVLQ----LAPRATVLASKIALQFLEGLVHDPFSKR-----------------------------------------IVKSGDRIDIGGHEIEFVSAPNLHWPDTIFSYDRKTEVIYTCDAFGMHFCDRFYYDCLMGPNARSLLNAMKRMGDL--GKIKIIANGHGPLL--YHHLDVLTECYQSWSQRQAKSETTVGLFYVADYGYSNLLVIGEGIQKTGVAVEMIDLSTAEIQEIQELAAGLIIGMPPSLLSVVKDKQAVGLFECFGGDDEPVDTIRRKFIDLGVKEAFPAIRIKDVPGASAYQLCTEAGTDLGQL.............................................................................................................................................................. 409
5 -20.800[R] COG0491 Zn-dependent hydrolases, including glyoxylases  ali follow..  13  13................................................................................................................................TNCYVVRGENEVAIIDPGM--HAHDDLVEYITTN--NLSVDKIVLTHGHIDHTRDAGVVAKRFN-----APVYIHPDDAFFLEVYKGSGTKTAMLFDA------------------------DNMVSPDPESLRDLVDGETITLAGEEFTLKHAPG-HSPGCTLIVGKE--YCFSGDVLFKGSIGRTDFEWS---DADAMNESLRT--AVLPLDDALILPGHGPTTTRAERTGN.......................................................................................................................................................................................................................................................................................................... 207
6 -17.700[R] KOG0814 Glyoxylase  ali follow..  53................................................................................................................................TYSYLLADLKN-VIIDPVL--EQAKRDAQLVKDL--GFELKYAINTHMHADHITGSGWLRKLTG-----CQSVIAAA----------------------------------------------------AKADRHLNEGDRIDFGTHVIDALATPG-HTNGCMTYVIKDQGCVFTGDTLLIRGCGRTDFQEG---CPRNLYENVHS--KIFTLPENFIYPAHDYKGQMESSVWEE-KRYNPRLTKDIEEFVKIMENL--------NLPYPKKI................................................................................................................................................................................................................................................................... 254
7 -16.400[I] COG3255 Putative sterol carrier protein  ali follow..  17  6....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PSKEWMEELYKKVNADEEYRRVAANWEGDYLCVVELDEEALR-----FQNPKVLRGFLGMLDSIPKEKRERFRGTPSEKLLEALGLSLDEEIAKKIAENPDKILEGASLNIWMDFWHGDFRVAAPGEHEDAKFKLIGPYAVFKQLVMGKADAITLVVSGKLKLQGDMGYMMRNMATVKKFTDLMASIPIET. 206
8 -14.300[R] COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  11  60................................................................................................................................SLALFLKIGKVGILIDPGVALKALSLAREKIQEYAKK--AQIVTISHYHYDHHTPFFEGIYESSSVEKAREIYAGKLLLIKHPTENINNSQKKRAHEFLK-------------------------NAKEIAKDIKFADSQSFDFGSFTIEFSPPVPHGREGSVLVDDGKKSVLHASDTIIEKNPDILIAGGPHRVGNVKEIGMKNINRIISETNAKIVLDHH---IIRDKGYERFFSELDERPLTFAEAPLEAYRRELHKLEKGEEVEVPGGIKK................................................................................................................................................................................................................................................................. 346
9 -13.900[S] KOG4736 Uncharacterized conserved protein  ali follow..  13  296................................................................................................................................GAITLVNDNGYIVLIDTGASSDTERLLHSLAKESVTLDQIDSVVITHASPGHMGNMNFF--------AQKPILYHSMEYIGRH---------------------------------------------VTPTELKERPYRKLSGN---VEVWKTPG-HTQHDLSVLVHNVTMAIVGDLIPSEHLLSEKRDVMIEEGVWDNAIKRQNANLIVCM-ADWIVPGHGQPFRVLPNYRQKAGCTR.................................................................................................................................................................................................................................................................................................... 481
10 -12.400[R] COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II  ali follow..  29..................................................................................................................................SALVESNGYKVLVDTGTDGKVLLNNMHELGIDAND--IDVLFITHGHYDHTGGLKEFLK---ERSEPIEVYAHPGIFDERIALKPRKRDIGIPFQRKELEELGARFNLSPEPLEFLPGFISSGEIKRVTWDRAVGYFPDGRKDPVR-----------DDMALIVEGSKGLVVISGCGHSGIINIAALIGGFHLRGAKKELLDDVVTNMKELGVNALYPGHCTGIEEFSYLWSKLDNV..................................................................................................................................................................................................................................................................................................... 261
11 -11.900[A] KOG1137 mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit)  ali follow..  10  35................................................................................................................................RSCVYMSFRGKNILFDCGIHPAYSGMAALPYFDEIDPSSIDVLLITHFHIDHAASLPYFLEKTTFNGRVFMTHATKAIYKLLLTDYVKVSKVSVEDMLF----------------------DEQDINKSMDKIEVIDFHQTVEVNGIKFWCYTAGHVLGAAMFMVDIAGVRILYTGDYSREEDRHL-STSGVQLHQSRH-KRFTDVIHSTVAQGGRVLIPAFA--LGRAQELLLILDEYWANHPDLHN--------------------IPIYYA---------SPLAKKCMAVYQTYILSMNDRIRNQFAFKHISPLNSIDDFNDVGPSVVMATPGGLQSG------LSRQLFDSWCSDKKNACII-------PGYMVEGTLAKTI-INEPKEVTNGLTAPLNMQVHYISFSAHADYAQTSTFLKILVHGEANEMMRLKTKIMTPKNCESVEMYFNSEKLAKTIGRLAEKTP-----VGDTVSGILVKKGFTYQIMAPDELHVFSQLSTATVTQRITIPFVGAFGVI..... 533
12 -11.700[K] COG1733 Predicted transcriptional regulators  ali follow..  10  12............................................................................................................................................................................................................................................................................................................................................................................................................................................................LSMAAEVLCTRWTMVLMRELVAGSTRFN---DLRRGVPKMSPTSQRLKELELAGIVERKEVPGEKGIFDYRLTEARPVVEAMGFWGQKWVESRLSLKNLDPSLLMWDMRRNLNPSPLPEGRTVIQFLYQDKRSWWLIVEKHGEVDLCWYDPGFDVDLYVSTDLHTMTAIWMGLLTVEKA--GGKVALTGDQAIGKKMQTWLG.............. 218
13 -11.700[I] COG3154 Putative lipid carrier protein  ali follow..  16  20..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PLKVTPFALQRQVLEHVLGGELAFLESRWLKIEVRDLALQWFVTVENGKLLVSQ---QADADVSFSGDANDLILIAARKEDPDTLFFQRRLRIEGDTELGLYVKNLMDAID........... 136
14 -11.200[J] COG1236 Predicted exonuclease of the beta-lactamase fold involved in RNA processing  ali follow..  10  2...............................................................................................................................LSVISSEIGVISKKLIDLGVLAELRTFSIDTTRSPGKQPQPDAYLITHAHSDHHGKSAMLSPRAVCTDKTATALEIRHDRKYVGS--------------------------------------------------MCRLGDEIEIEGVRVKTYPTAHTAGAAAFYWENDVTRILVTGDVKNAS---TEANYGDPEDPSCHFADDLESMKCALFESGPVAFGAYE---FGKQRAVELMRGFGYEGAIRMEARTRALTRSMLEDAGELAVVAPWDLDKLPRNVKKYCRADYPYPIIISDHLDA-----CGLEDMVRKLTPEVTLVYHPGGHRPSKFSKHLNSIGIDSISIDQIGNVLSNE............................................................................................................................................................................... 347
15 -10.500[R] COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain  ali follow..  11  66.......................KSLKPPEKARQIIMQIEDARISNIFFDEENGIEAEKPGVVIGKQGSTFREIMRAVGWSPRVVRTPPIKSKIIDNIRNYLLSVREERSEILKRIGERIHRTSLID-RSCYLLQTPESRILIDCGVNVNLSSTPYLYVPEVQPLDALDAVVITHAHLDHCGLVPLLYKF-----------------------------------------------------------------------------------GYRGPIYLTPP--TRDLMVLLQLDFLEVAGREGTNPPYSSNLIREALKHTITLDYGVVTD------DVRLTFYNAGH---ILGSAIAHFHIGEGHYNIAFTGD--------KFEKTRLFDRAATNFPRLEALVMEATYGSRKEAEERLIEVINRTLDRGGKVLIPT-----------AVGRSQEVMIVLEEAMREKRLRETYVYLDGMIY---EATAIHTAYPEYLNAQLRDLIFYHGINPFISENFVRVDSSSKREEVISDPSPSIIIATSGMLNGGPVMEYFRHLAEDERNTIVFVGYQAEGTLGRKIQKGWKEVPFPVDGRREVVEVKMEVETVDGFLMNYIRYLNSKPEKVATVHGDESKCIDLASSIYK-TYRIETRAPM.. 624
16 -10.400[A] KOG1136 Predicted cleavage and polyadenylation specificity factor (CPSF subunit)  ali follow..  17................................................................................................................................RSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYIVPEGIDCVIISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFF---------------------TTQMIKDCMKKVIPVTLHQSMMVTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDRHL-STYATTIRDSKR-RDFLKKVHECVAKGGKVLIPVFA---LGRAQ-----------------ELCILLETYWERMNLKYPIYFALGLTEK-------------ANTYYKMFITWTNQKIRKTFVHRNKPFDKAYIDNPG--AMVVFATPGMLHAG------LSLQIFKKWAPNENNMVIM-------PGYCVQGTVGNKIL-AKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQMLVHGEAGKKDEFNLETYMPANGETCVISTPVKIPVDASVSLLKAEARSYNAQPRLIHGVLVMKDNRIMLQNLTDA............................... 500
17 -10.200[R] COG0595 Predicted hydrolase of the metallo-beta-lactamase superfamily  ali follow..  11  18.................................................................................................................................NMYLVEVEEQIFVLDAGLKAEMDQLGVDFVIPDITADRVAGIFLTHGHADSIGALPYIVSE------KVPVFGSELTIELAKINVKNYADSRKFNDFH-----------------------------------VVTEDTEIDFGKAVISFFSTTHTIPESGIVISTNDGNIVYTGDFRFDPAVNMRRLAEIGNSGVLALLSSSPNALSTMQSASEHEIYEKIYDYIDDNEGRVIIACNAGNLGRIQQTIDAAIKLGRRVAFTGEDMDQIIETATR---------------------LNKLQIVDKKSAEIKKYADNELVILETGRMGEPLKSLGDMAHRRHKYVKIKDGDLVLAVTVSYETTIARIENEIYKAGGVMKMLASDLKISGHANA----------------------DLQFLLDIFRPKN---------------LIPIQGEYRELSAHADLAMEMDILPEH---IFIAKRGETVSLENGDMIPSGVIQAENVMIDGS.......................... 442
18 -10.000[R] COG2333 Predicted hydrolase (metallo-beta-lactamase superfamily)  ali follow..  10  87..........................................................................................................................TLDVGQGLATLIVKNGKGILYDTGSSWRGGSMAELEILPYLQREGIVKLILSHDDNDHAGGASTILKAYPNV----------------------------------------------------ELITPSRKNYGENYRTFCTAGRDWHWQGLHFQILSPHNVVTRADILVDDGKNSVLLTGDA----------------------EAKNEQIFARTLGKIDVLQVGHH---SKTSTSEYLLSQVRPDVAII---SSGRWNPKFPHYSVMERLH---RYKSAVENTAVSGQVRVEIQQARTKFSPWYA...................................................................................................................................................................................................................................... 328
19 -10.000[R] COG1235 Metal-dependent hydrolases of the beta-lactamase superfamily I  ali follow..  45..............................................................................................................................GNTICIEVRCGDHVLLFDAGSGLHPAGLALRA-----EGITDVNLFFSHCHYDHIVGFPYFKP---NSSNDVAIWSGHLAGSMTTREM-----LKDFMSPPWFPVPLEICCAKIATRDFKAGDVLDVHPGLSIRTGMLNHGYRLDWEGKSLAIIEHEPSSIDETVLDLIRDVDLFLYDAMFTD----------EEMGLYRGYGHS-QAIRLAKLADAKNVGFIHHAPSRSDEELDDIEKQAKAEFNGA.............................................................................................................................................................................................................................................................................................. 281
20 -9.360[A] KOG1135 mRNA cleavage and polyadenylation factor II complex, subunit CFT2 (CPSF subunit)  ali follow..  11  18................................................................................................................................PLCYLLQVDGDYILLDCGWDERFGLQYFEELKPFIPK--ISAVLISHPDPLHLGGLPYLVSKCGL---TAPVYATVPVYK--MGQMFIYDMVYSHLDVEEFEHYTLDDVDTAFEKVEQVKYNQTVVLKGDSGVHFTALPAGHMLGGSIWRI-----CRVTGEDIVYCVDERHLNGCSFDNFNRPHLLITGAHHISLPQM-EQLVTKILRTVRQKGDCMI-----VIDTAGRVLELA--------HLLDQLWSNADAGLSTYNLVMMSHVASSV-----VQFAKSQLEWMNEKLFKYDSSSARYNPFTLKHVTLCHSHQELMRVRS--PKVVLCSSQDMESG--DWCSDPRNGVILTARPASF--------------------------TLAAKLVNMAERANDGVLKHEDRLISLVVKK-----RVALEGEELLEYKRRKA---DAEETRLRMERARRQAQANESDDSDDDDIAAPIVPRHSEKDFRSFDGSENDAHTFDIMAKWDNQQKASFFKTTKKSFPMFPYIEEKVK 500
21 -9.250[T] COG5212 Low-affinity cAMP phosphodiesterase  ali follow..  2..........................................................................................HAALEIKEAEFQTDQVVGLVENSFTLY-GQNGGPLESCCSSHLISAFQEIISLDGGSHLSALVELIQAKAWHLSEQRIKTFLITHCHLDHIYGA-VINSAMFGPQNPRTIVGLNYVIDTLKKHV----------NNLLWPSLDKAGFINFQVVEPSMYTSLTTTLSILPFPVNHGSSFGQELKSSAFLFRNNLSDRY------------FLAFGDV--MVASEPLNIHIWRACSSLIAQRKLSHIL-STPDIPDTLLFGHFCPRHLVNELCILQSLVQSYGVIMPTLTCHPLQSANPADVILEQLE........................................................................................................................................................................................................................................................................ 323

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.