current user: public

If you have questions about the server, please let us know.

Query: [M] COG2027 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480
# Score Template Links and tools%idFirst MHFSRIVSGLACSIILNISVSNANAAQVENYTQYLPDGANLALMVQKIGASTPAIDYHAQQMALPASTQKVLTALAALLQLGPDFRFNTTLESHGTITDGVLRGNLIARFGGDPTLTRQQLRNMVATLRKAGVKQIAGDVVIDTSVFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPNPGDTAFIRVASYYPVQMFSEVRTLAKGSPDAQYCELDVVPGELNRFTLTGCLTQRSEPLPLAFAVQNGASYAGAILKDELKKADIQIDGNLRRQTIPSPAGNVLAQTQSAPLHDLLKIMLKKSDNMIADTVFRTIGHQRFGVPGTWRSGADAVRQILRQKAGVDLGNSIVVDGSGLSRHNLISPATMMQVLQYIAQNDQELNFISMLPLAGYDGTLRYRGGLHEAGVNGKVSAKTGALQGVYNLAGFITTASGQRMAFVQFLSGYAVPPEDQKNRRAPLVRFESRLYKDIYQNNLast
1 -130.000[M] COG2027 D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 4)  ali  100  1MHFSRIVSGLACSIILNISVSNANAAQVENYTQYLPDGANLALMVQKIGASTPAIDYHAQQMALPASTQKVLTALAALLQLGPDFRFNTTLESHGTITDGVLRGNLIARFGGDPTLTRQQLRNMVATLRKAGVKQIAGDVVIDTSVFASHDKAPGWPWNDMTQCFSAPPAAAIVDRNCFSVSLYSAPNPGDTAFIRVASYYPVQMFSEVRTLAKGSPDAQYCELDVVPGELNRFTLTGCLTQRSEPLPLAFAVQNGASYAGAILKDELKKADIQIDGNLRRQTIPSPAGNVLAQTQSAPLHDLLKIMLKKSDNMIADTVFRTIGHQRFGVPGTWRSGADAVRQILRQKAGVDLGNSIVVDGSGLSRHNLISPATMMQVLQYIAQNDQELNFISMLPLAGYDGTLRYRGGLHEAGVNGKVSAKTGALQGVYNLAGFITTASGQRMAFVQFLSGYAVPPEDQKNRRAPLVRFESRLYKDIYQNN 482
2 -14.200[V] COG2367 Beta-lactamase class A  ali follow..  12  57...................................................................................................................................................................................................................................................................IMMAVLKAASEGRIDLDQPVTYEKRLSGMFRYMTPGIVISLRDAIAGMMVLSDNVCTKMVLERLT-------------LEEVDGYCKS-LGMAIPPLALAADHPLKTVTTTSAADQVLLLQTILDAQSSPEAQAKLGCS-LKNQILRYGIRSRLPFEAMVASKSGRGKRGRMDAGIVYRNGAPSFIITTYTDEVPQVMPDGTPGYTIALETIGRLAQACWDG. 285
3 -8.560[V] COG2602 Beta-lactamase class D  ali follow..  11  1MKKWIYVVLVLSIAGIGGFSVHAASSVSKMNVDDEFKDTDGTFILHDLQKDQTFVRKRANQRQTPQSTFKVVNALIGLQ-------------------VKAVRDEYDVSWNRDHTLGSA-YQALARDI---GEERMK-------TWLHTLSYGNEDISGGIDQFWLQS-----------SLTISPLEQETFLEKLAKEDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDMGLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGL................................................................................................................................................................................................................. 264
4 -7.280[M] COG1686 D-alanyl-D-alanine carboxypeptidase  ali follow..  19  1MNITTIAKRLSLLVLFIAPTAGWAAE---SMVPAPPQLAAKSYVLMDGESGQVLVENNGDQRLPPASLTKLMTAYIATKEI-------------------------------------------------------AGRIGENDL--------------------------VTVSEHAWRT--------------------------------------------------------------------------------------------------------GGSRMFIKVGSQVSVSDLLHGIIIQSGNDASVALAEHIA-------GSEDAFADMMNTTAQK---LGLTNSHFMDATGLPNPDHYSSARDMAVLAIIYGEPSHYAIYAEFLWNNIKQPNRNLLLWRDKTVDG---LKTGHTDE----AGYSAVRDGQRMIAVVFTNSEQARAAETQKLLT................. 270
5 -5.940[T] KOG4038 cGMP-phosphodiesterase, delta subunit  ali follow..  10  29..........................................MNLRDAETGKVLWQSTEDKAHVPKNLLKCRTVSREINFTSSVKIEKFRLEQRVYLKGTIIEEWYFDFGFVIPDSTNQNMIEAAPESQMFPPSVLSGNVVVETLFYDGDLL.......................................................................................................................................................................................................................................................................................................................................... 148
6 -5.580[C] COG1151 6Fe-6S prismane cluster-containing protein  ali follow..  192................................VHEEQNCVASCLTNVDGSHISLAMKALRLGIATIYNTQIGLEMVQDILFGTPTPHEVNMDLGIMDPEYV---NIVFNGH-QPWIGAPEIQDMAKQAGAKGLR-VVGSIETGQELLQRFPVDEGNWLAIEPLLATGTVDIFAMEENCSPPAIDMYAEKYQVTLAAVSTIIDLPGVNYKFPYDPAQADETAQRLIELGIENFKKRKERQIKPHVPQKIQKAIAGFSTEAVLGALGNKLDPLVDVIKGQIKGVVALANCSTLRNGPQDWVTINLTKELIKR------DILVVSGGCGNHALECTLDAANNIAGNGLKAVCNALKIPPVLSFGTCTDTGRISMVTALAEHLNVD---------VPQLPIAVT--------------APEWMEQKATIDGGAYTHLSPTPFMTGARQLVDLLTNKAEDVTGGKIALGDDPMKVANDIEDHIMRKR 633
7 -5.280[D] KOG1042 Germ-line stem cell division protein Hiwi/Piwi; negative developmental regulator  ali follow..  442..............................................GLSFDSNLLSFSGRILQTE----KIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMI-----------------DDRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQT---------------------------------------VMAIATKIALQMNCKMGGELWRVDIPLKLVMIVMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVC---QAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCL--KSIGRGYNPRLTVIVVKKRVNTRFFAQSGGRLQNPLPGT-EVTRPEWYDFFIVSQAVSPTHYNVIYDNSGLKPDHIQRLTYKLCHIYYNWPGVI.... 826
8 -4.670[L] COG4581 Superfamily II RNA helicase  ali follow..  292...................................LEMGDSVFVAAHTSAGKTVVAEYAIALAQKHMTKAIYTS--PIKALS-NQKFRDFKHKFEDV--GILTGDVQVNPEGSCLLMTTEI---LRSMLYRGADLIRD-VIFDEVHY--NDLERGVVWEEVIIMLPPHVTLILLSPNTKEFASWVGRTKKKNIYVISTLKRPVPLEHYLWV---KQNMFKIVDQHGRFLMDGYKSANDALKKPDKPVIAKDNKNSARGRGAARGRGVQTNMMRGRGSAKSVERRDANTWVHLIGHKQNLLPVIVFVFSKKRCEEYVDTLTNNNHQEKSEVHVVIEKAVARLKKEDRLLPQIGRMREMLSRGLAVHHGGLL---------------PIIKEIVEIL----QRGLVKVLFATETFAMGVNMPAKSVVFSGTQKHDGYCSGRAGRR-TVIILSRSELPDTASLRHMIMGPSSKLISQFRLTYN.. 733
9 -4.670[O] KOG0185 20S proteasome, regulatory subunit beta type PSMB4/PRE4  ali follow..  30...............................................................................................................................................................................................................................................................PMVNTQQPIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNG------VERLIPVGDNTVVGI-----------------SGDISDMQHIERLLKDLVTENAYDNPL-ADAEEALEPSYIFEYLATVQRRSKMNPLWNAIIVAGVQSNGDQFLRYVNL---------LGVTYSSP----TLATGFGAHMANPLLRKVVDRESDIPKTTVQVAEEAIVNAMRVLYYRD 221
10 -4.640[S] COG0779 Uncharacterized protein conserved in bacteria  ali follow..  13  13..........................................................................................................................................................................................................................................................................................................................MITAPVEALGFELVGIE--IRGRTSTLRIYIDSEDGIN-----VDDCADVSH-------QVSAVLDV--EDPITVAYNLEVSSPGLDRPLFTAEHYARFVGEEVTLVLRMAVQNRRKWQGVIKAVDGEMITVTVEGKDEVFALSNIQKA................... 146

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24