current user: public

If you have questions about the server, please let us know.

Query: [C] COG2033 Desulfoferrodoxin, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MVKFAAKWCAKSLVHHKAKVIGMLKETIRSGDWKGEKHVPVIEYEREGDLVKVEVSVGKEIPHPNTPEHHIAWIELYFHPEGGQFPILVGRVEFTNHSDPLTEPRAVFFFKTSKKGKLYALSYCNIHGLWENEVQLELast
1 -78.700[C] COG2033 Desulfoferrodoxin  ali  100  1MVKFAAKWCAKSLVHHKAKVIGMLKETIRSGDWKGEKHVPVIEYEREGDLVKVEVSVGKEIPHPNTPEHHIAWIELYFHPEGGQFPILVGRVEFTNHSDPLTEPRAVFFFKTSKKGKLYALSYCNIHGLWENEVQLE 137
2 -11.600[S] COG5501 Predicted secreted protein  ali follow..  140...........VKASGGCSAPATKDPVAALKDMGEMRKLFGGKGEVQKARREAQIMI----RHPNYSAKFITELVVKQGDELLFALDG--------GISISENPVFRFSYTDNGAPDFTVHAVDTDGNVFDRVLPKT 267
3 -8.740[S] COG4899 Uncharacterized protein conserved in bacteria  ali follow..  1..MYTCTSCGEKHEDMPAIGFTAPYPYNQLSEEERIAYQAECDSDPDQTDRFIRAVLPIPIIGHEETLEYGVWVSVSEKS......................................................... 84
4 -7.950[C] COG3241 Azurin  ali follow..  10  64.............................ESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKTSM-GHNIVIGKTEDMDGIFKDGVGAADTDYTKLIGGGEESSLTLDPAKLADGEYKFA--CTFPGHGNGKVTLV 182
5 -7.860[S] COG3148 Uncharacterized conserved protein  ali follow..  27.RVRRCQRCLLPLKSCLC------------------DTLTPSQAK-------SRFCL---VMFDTEPMKPSNTGRLIRTEPPQALLELVQHPDYQPIVVFPASYAGEAREVISTPPAGKPPLFIMLDGTWPEARKM. 146
6 -7.830[A] KOG3454 U1 snRNP-specific protein C  ali follow..  14  1MPRYYCDYCDTYLT--------------HDSPSVRKQHN-------------------AGYKHKANVRIYYQQFE.............................................................. 42
7 -7.800[A] COG5136 U1 snRNP-specific protein C  ali follow..  11  1MTRYYCEYCHSYLT--------------HDTLSVRKSHL-------------------VGKNHLRITADYYRNKA.............................................................. 42
8 -7.440[R] COG4469 Competence protein  ali follow..  28...FRCPACKSPVR-----------LRQGTIRRPHFAHVQLAHCQFQAE--------NESEEHLTLKAKLYTSLV---RTEAVCIEKYLPELQQIADLWVNDKLALEIQCSPLPVERLKAYQEKGYPVRW....... 136
9 -7.410[O] COG2999 Glutaredoxin 2  ali follow..  15  1MKLYHCPFCVKARMIFGLKNIPVELNVLQNDDEATQKMVPILQKDD-----------SRYLPESMDIVHYVD................................................................. 70
10 -7.180[K] KOG2906 RNA polymerase III subunit C11  ali follow..  10  1MEF--CPTCGNLLSRFFCCPYVAYIQRQVEIKKKQLLVKKSIEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPESR.................................................... 92

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.