current user: public

If you have questions about the server, please let us know.

Query: [R] COG2085 Predicted dinucleotide-binding enzymes, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MSHTKPSIAILGAGRVGSSLARSAVAAGYEVKVAGSGAVDKIALTAEILMPGAVPSTADQAVKDADIVFLAVPLHKFRSVNPATLEGKIVIDTMNHWVPVNGELEEIDQDPRSTSEIIAEFFAGSTMVKSFNHIGYHEIEQDAGTGRAIAYATDDVDAGAQVAQLIKSFGFVPLNIGALENGRILEPGQEAFGAHLNKDSRLELVNQRLast
1 -84.500[R] COG2085 Predicted dinucleotide-binding enzymes  ali  100  1MSHTKPSIAILGAGRVGSSLARSAVAAGYEVKVAGSGAVDKIALTAEILMPGAVPSTADQAVKDADIVFLAVPLHKFRSVNPATLEGKIVIDTMNHWVPVNGELEEIDQDPRSTSEIIAEFFAGSTMVKSFNHIGYHEIEQDAGTGRAIAYATDDVDAGAQVAQLIKSFGFVPLNIGALENGRILEPGQEAFGAHLNKDSRLELVNQR 208
2 -18.900[I] COG2084 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases  ali follow..  21  3......TIGFIGLGIMGAPMAGHLLDAGYKVIASDHRSKPLADLVAK---GLKTVSGHAAVAKAADIIITMVPDTPQVAVASGLTRGKLVIDMS------------------SISPIETKVFAGKINELGCDYLDAPVSEVGAKAASLTIMVGGEEKAFERAKPVFEKMGKNITLVGPNGVGQTTK...................... 171
3 -18.800[S] COG5495 Uncharacterized conserved protein  ali follow..  17  7LRSARLNIAILSTGRVGVALER----ADQVVVACSAVSHASRQWVQFRLPETS-VASPPEVASSAELLLLAVPDCEFAGLMSGVRPGTIVAHTS----------------WANGVGILAQLGKDGCIPLAIHPAMMFSGSDEDLSQCQLGITKTDDVGYAIAQSLVLEMGGEPFCVVE.............................. 174
4 -18.700[E] KOG2380 Prephenate dehydrogenase (NADP+)  ali follow..  10  49.ATPPLRIAIIGFGNYGQFLAETLISQGHILFAHSRSDHSSA---ARRLGVSYFTDLHDLCERHPDVVLLCTSILSIENILKTL-RNTLFVDVLS---------------KEFAKTLLLQYLPEDFDILCTHPMFGPQSVSSNHGWRGLRFVRLRVSRCESFLEIFVREGCEMVEMSVTDHDKFAAESQFI................. 235
5 -18.600[G] COG1023 Predicted 6-phosphogluconate dehydrogenase  ali follow..  17  1.....MQLGMIGLGRMGANIVRRLAKGGHDCVVYDHDPDAVKAMAGEDRTTGVALRELSQRLSAPRVVWVMVP-AVIEELANTLEAGDIVIDGGN--------------TYYRDDLRHEKLLFK----KGIHLLDCGTSGGVWGRERGYLMIGGDGDAFARAEPIFATVA...................................... 154
6 -17.400[R] COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase  ali follow..  16  1..MSTMKVAVYGAGNQGSRMAIEFAEAGHDVVLAEPARDMLDDAHWKVVEDAGVTDNDAEAASEAEIAVLFTPFGKAKNITNHLPEGAVIANTCT----------VSPVVLYYVLERELRRDRKDLGIASMHPAAVPGTPQHGGGHSSSELDIATDEQISRCVELAESCGKVAYVVPADVSSAVADMGSLV................. 210
7 -16.300[G] COG0362 6-phosphogluconate dehydrogenase  ali follow..  14  1MS-VKGDIGVIGLAVMGQNLILNMNDHGFKVVAYNRTTSDEFLQGAAKGTNIIGAYSLEDLAAKLEKPRKVMLMVRIEALLPHLEEGDIIIDGGN------------------SNYPDTNRRVKALAEKGIRFIGSGVSGGEEGARHGPSIPGGNQEAWQYVKPIFQAISAKTEQVGGEGAGHFVK...................... 185
8 -16.300[G] KOG2653 6-phosphogluconate dehydrogenase  ali follow..  12  1...MSADFGLIGLAVMGQNLILNAADHGFTVCAYNRTQSDHFLANEAKGKSIIGATSIEDFISKLKRPRKVMLLVKINQIVPLLEKGDIIIDGGN------------------SHFPDSNRRYEELKKKGILFVGSGVSGGEEGARYGPSLPGGSEEAWPHIKNIFQSISAKSEWVGPAGAGHYVK...................... 182
9 -15.400[EH] COG0059 Ketol-acid reductoisomerase  ali follow..  13  36...KGKKIVIVGCGAQGLNQGLNMRDSGLDISYALRPEAEKRASFQRATENGFKVGTYEELIPTADLVVNLTPDKQHSKVVADVMKKDSAFGYSHGFNIVRKDITVVMVAPKCPGTEVREEYKRGFGVPTLIAVHPE--------------NDPKGEGMAIAKAWAAATG...................................... 199
10 -14.300[E] COG0287 Prephenate dehydrogenase  ali follow..  19  9......RIALIGIGLIGSSIARDVRELGLARVVISTRSEDTLKRAEELALGTDYTVSAAEAVKDADLVIVSVPVGASESVAQQIAPSAIVTDVGST--------------KASVIAQMAPHMPENVHFIPGHPLAGTEKSGPDAGFAGLFLPGTDAAALERLKDFWRALGSRVDEMDAEHHDKVLAIVSHL................. 193
11 -14.000[E] KOG3124 Pyrroline-5-carboxylate reductase  ali follow..  17  1.....MSVGFIGAGQLAYALARGFTAAGHKIIASSPEMNLPTVSALRKMGVNL-TRSNKETVKHSDVLFLAVKPHIIPFILDEI-ARHIVVSCAAGVT-------------SSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTHALVED---GQLLEQLMSSVG---VEEDLIDAVTGLSGSGPAY................ 180
12 -13.300[R] COG1712 Predicted dinucleotide-utilizing enzyme  ali follow..  15  2.....LKIGIVGCGFIGGQICRAIDGVSAELYALCDSSESKALELAASLKTCKPSYMKIELIRGVDLIIESASQNAVRFIVPQALKAGCDVMILSVGALADEELRDTLFGLAKEHNCKLYFPSGA................................................................................... 124
13 -12.700[H] COG1893 Ketopantoate reductase  ali follow..  12  1..MEKPRVAVIGSGSIGLLLYAYLKLANWPALLVTNRPEQADHLNKEGL-SVTATPLSSFSAEEAEVGFITVKSFAVKALLPQLKKWDGLVFFQNGM----------------THLEILRQIPARAICCGIVEIGAKRVQHTGDGAIWIGDMVGDSKNFDPMWACLHNAGLKAQKVTNWQDK.......................... 182
14 -12.600[C] COG0240 Glycerol-3-phosphate dehydrogenase  ali follow..  16  1...MKQHIGYLGMGIWGFCLASLLANKGYPVVAWSRNPDLIKQLQEERRHP-SFTTDMKEAIHNAFMIVEGVTSAGIRPVAEQL-LSVPFVITSKGIEQNTGLLLSGYLSGPSIAKEVLNGSPCSVVVSAYDSQTLKQIHEPNTDIKGAALGGALKNVIAIACGIAEGLSFGNNAKAGLVTRGLHE...................... 222
15 -12.600[R] COG2910 Putative NADH-flavin reductase  ali follow..  17  2.....AKIALIGSGNAGSRILKELSDRGHQVTAIARNPEKALPNVVAKKGDVFDQAALSELLKGHDAVISSV........................................................................................................................................ 71
16 -12.600[S] COG4408 Uncharacterized protein conserved in bacteria  ali follow..  3......KLLMIGTGPVAIQLANICYLKSDYIDMVGRASTEAHQHLEGKFEINRLYKDVKNVKGEYETVVMACTADAYYDTLQQLSSVKHVILISPTFGSQMIVEQFMSKFSQDIEVISFSTYLGDTRIVDKEA-PNHVLTTGVKKKLYMGSTHSNSTMCQRISALAEQLKIQLEVVESPLHAETRNSSLYVH................ 216
17 -12.300[M] COG0677 UDP-N-acetyl-D-mannosaminuronate dehydrogenase  ali follow..  15  11FKSRQALIGIVGLGYVGLPLMLRYNAIGFDVLGIDIDDVKPQAKIAKARASGFEATTDFSRVSECDALILCVPINTTDALKPYLRVGQVVSLESTTYP-------------GTTEEELLPRVQEGGLVRDIYLVYSPEREDPGNPNFETVIGGHTPQCLEVGIALYEQAIDRVVPVSSTKAAEMTKLLENIH................ 224
18 -12.200[MG] COG0702 Predicted nucleoside-diphosphate-sugar epimerases  ali follow..  13  31LANLPPLVTVFGSGFVGRHVVRMLAKRGYRIRVAVRRPDLAVGQISFAQANLRYRDSIIKAVEDADHVV-AVQEFGAKAIAEAARDTGATLTHISAIGADANSQTGYGRTKGRAEAAIHSVLPGAVILRP-------------------IIFGPEDDFFNKFAKMARNLPFQPVYVEDVAEA.......................... 228
19 -12.100[E] COG0345 Pyrroline-5-carboxylate reductase  ali follow..  18  1..MENQKIGFIGAGKMGSALMQGTIKAG-ENIGASDVYEPFLKDLQAKLGIRV-STDNAVIVRESDILILAVKPQTLSSVLSNL-SEKLVISIA---------------AGVPLSTYEDALLEGTRVVRVMPNIAATVSEAASGIAPGKNATPED---LKAALEIFSAVG---VPESLMDAVTGLSGSGPAF................ 179
20 -12.000[Q] COG4569 Acetaldehyde dehydrogenase (acetylating)  ali follow..  20  1..MSKRKVAIIGSGNIGTDLMIKILRHGQHAVMVGIDPQSDGLARARRMGVATTHEGVIGLMNMPDIVFDATSAGAHVKNDAALREDIRLIDLT.................................................................................................................. 103
21 -12.000[S] KOG2733 Uncharacterized membrane protein  ali follow..  17  1MSGDRLDVIIFGAGFTGKYTVFEAVTRGLRWGIAGRN-REKLEAVLKEMGAKAKK-------DLSQVPIFIADVNDQASLLEMAKKCRIVVNTAGPYR-------------------------GENVVKCCIESGTHHVD----------VSGEDQLAREKGVYVVSACGFDSIDMGVVFVEKNFD...................... 161
22 -11.900[C] COG4074 H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase  ali follow..  17  4.....MKLAILGAGVDEVVVADPVFDNQFTVIDHKEDPEKIMPQIREKVNEVAKTTDDREAVADADFIMTWFPKGDIDKFIDDIKPGAIVTHACT---------------PTTKFYKIFEEKHGDTKPETLNVTSYHPGAVPEMKGQVYIAEGASEEAINTLFELGQKARGNAYRLPAELLGPVCDMCSAL................. 261
23 -11.900[R] KOG2742 Predicted oxidoreductase  ali follow..  15  1...MLPGVGVFGTGEIANVLVPLLREKGFEVRAIWGRTLKEAKETATTQNVQFHTNVIDDVLLRKDVVFIVCQPFLHAEISVKALGGKHVV-CDKPAGLHQQDALKMVRASQYYPTLISRFLPAFTHMRRC............................................................................. 136
24 -11.400[I] KOG2304 3-hydroxyacyl-CoA dehydrogenase  ali follow..  18  24......NVTIIGAGLMGSGIAQVSANAKLNVTVVDDDAAAQTALVSSVLDRIKMSTNVSDSVKDADLVIEAIV-KLFAEVEVAAKPTTLITTNTSSL---------------RLADIGLNLKDKSRFGGLFNPVPMMKLLE------VVRHTETSDATFNQLVDYGKTVGKTTVACKD.............................. 208
25 -11.400[R] COG5322 Predicted dehydrogenase  ali follow..  13  159VEPADTEVAVVGYGSIALVIAKLLAGHGCRLCLVHRGSEAGLAYLPEPMHAQVRLSNDIEHCYEHVQFYVAATSTGGLIDPYRLRPGSVVVDAALPRDVKPNDILIIDGGLVSASSALRFGAESMGLAPLNGCLAETLILGLEGRAEAFSIGREPEDKVLEIGRIAELHGFSPSPM................................ 348
26 -11.300[C] KOG2711 Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase  ali follow..  11  20FSPKLISVGIIGSGNWGTAIAKICGENAKQVHMWMYEEKIQHEGKECNLTEVFNNPDIRDVGSRSDILVWVLPHQFVVRICNQL-KDAVAISCIKGVSVTKDRVRLFSDSGANIASEVAQEKFCETTIGYLPNSSVNPRYTPVEDVPGVALGGALKNIVAVAAGIIDGLELGDNTKSAVMRIGLLE...................... 266
27 -11.300[R] KOG4288 Predicted oxidoreductase  ali follow..  23  1.....MKIVVLGSGFLGHNICKLAIAKGYEVVSVSRRGAGGLHNKEPWMDD-KDPNSLLPVLRDASAVVNSV........................................................................................................................................ 76
28 -11.200[E] COG1748 Saccharopine dehydrogenase and related proteins  ali follow..  16  1...MKKNVLIIGAGGVAQVVAHKCAQNSDDIHIASRT-VDKCRKIVESVREKKSLKTEVKLSTGSQIVINVGSAFVNMSVLRACMDTGVYMDTA------------------IHEEPNKICETPPWYGNYEWKR--------------------AAECKEKGITAILGVGFDP................................... 153
29 -10.900[I] COG1250 3-hydroxyacyl-CoA dehydrogenase  ali follow..  13  4......TVGIIGAGQMGCGIAHVSAAAGYKVQLYDIAADKMSDEDRKRALSLIKGSGDINDLAQADLVIEAVT-KIYGQVCPVMRPDAILATNTSSL---------------SITRLASATDRPERFMGIMNPVPVMKLVE------LVRGIATEEETFKAAKEFVAHLDKTVTVAED.............................. 182
30 -10.900[C] KOG2865 NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit  ali follow..  64SSVSGIVATVFGTGFLGRYLVQQLAKMGSQVLVPFRGSEDSLGQVVPMKFDPRDEDSIKAVMAKANVVINLI--EKLALVCEHGGIMRYI---VSCLGASVSSPSRMLRAKAAAEEAVLNALPEATIMRP-------------------TMIGTEDRILNPWSMFVKGTTKYPVYVVDVAAA.......................... 262
31 -10.300[H] COG0476 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 2  ali follow..  13  140...SMLRVGVIGCGGTGSAIAMLLPKMG------------------------------------RNIALF-------------------IVEDTN-HGARQPDADAMSPKVEVVAKSLVELGLGVQVRTYQAWIGEADCRDPLKACDVIFCCTDDHTGRLMLNRFAYYYATPVFDMG............................... 265
32 -10.200[H] COG0499 S-adenosylhomocysteine hydrolase  ali follow..  21  259.....KNVLVCGYGDVGKGCAEAFDGQGARVKVTEADPINALQALMD----GYSVVTVDEAIEDADIVITATGNKDIFEQMLKMKDHALLGNIGH................................................................................................................. 346
33 -10.100[S] COG3268 Uncharacterized conserved protein  ali follow..  16  1MSPDKREFDIVGAGFSGKLTAEHLALSTARIALAGRS-SERLRNVRALLG-----------PNAQDWPLIVADASQPSTLEAMAGRAQVVLTTVGPYT-------------------------GLPLVAACARTGTDYAD----------LTGEHKQAAATGARIILACGFDPSDLNVYQLYRRVI...................... 159
34 -10.000[Q] COG5310 Homospermidine synthase  ali follow..  10  13YGEITGPVVMIGFGSIGRGTLPLIERHFKRMTVLDPRDTDRKLLDERGIAFVQEAVTENNNGGGQGFCVNLSVDTGSVDLMRLCRKGVLYIDTVVEPWLGFYFDAKADNASRTNYALREAMI--------------------------------EKHDKPGGATVVSTCGANP---G............................... 170
35 -9.880[CHR] COG1052 Lactate dehydrogenase and related dehydrogenases  ali follow..  20  147.....SRVGILGTGRIGQAAARLFKGVGAQVVGFDPYPNDAAKE-------WLTYVSMDELLSTSDVISLHMPATK-AKTIAQMKDGVYLVNTAR................................................................................................................. 235
36 -9.700[E] COG4091 Predicted homoserine dehydrogenase  ali follow..  13  16.TGKPIRIGLIGAGEMGTDIVTQVARMGIEVGALSARRLPNTFKAIRTAYGDETESAMTRAIEAGKIAVTDDNDLILSNPLID-----VIIDATG-------------IPEVGAETGIAAIRNGKHLVVEADVTIGPYLKAQADKQGVIYSAGDEPSSCMELIEFVSALGYEVVSAGKGKNN.......................... 191
37 -9.610[R] COG0673 Predicted dehydrogenases and related proteins  ali follow..  13  1..MKTVNIGLIGAGRIGQLHASNIISSYMELKAVSDVQLDHLKGTEIERSVEIMTTNPDELFSNRDIIFICSSTDTHAAFIKAAALAGKHIFCEKPISFHVTETKGALNIVNEAGVKFQ----NRRYDKHFRRVQECVQAGAIGAPHIIRVSSRDPEAVERSGGMFMDMTIHDFDM................................ 181
38 -9.600[E] COG0136 Aspartate-semialdehyde dehydrogenase  ali follow..  11  15RRKMGFKVAVAGTGNVGREMLNILEERGFPADVVPLASRRSQGTEVSYGDKTLKVRALDTDFSDTDICLMSAGGSVSQEWSPKIGRGCVVIDNSSAWRYDADVPLIVPEVNPDAIAGFTKANPNCSTAQLVVALKPLHDAAKIKRVVVSTYQSVSGAGKEGMDELFEQ........................................ 190
39 -9.500[R] COG2344 AT-rich DNA-binding protein  ali follow..  18  83..DEMTDVILIGVGNLGTAFLHFTKNNNTKISMAFDINESKIGTEVGGV-PVYNLDDLEQHVKDESVAILTVPAVAAQSITDRLVALGI....................................................................................................................... 170
40 -9.270[H] KOG1370 S-adenosylhomocysteine hydrolase  ali follow..  17  190VMIAGKVAVVAGYGDKGKSCAQALRGFRASVIITKTDPIKALQAAME----GYEVTTMDEACQEGDVFVTTTGCVDIGQHFEQTKDDTIVCNTGY................................................................................................................. 282
41 -9.130[E] KOG4354 N-acetyl-gamma-glutamyl-phosphate reductase  ali follow..  11  15VSSKPAKVVLLGRGYTGKNLIGLINTHPYSHVSSRELEGTKLPGYTKKEIQSTDDVKKLEEEGAVDAWVMALPNGVCKPYVDALTSKSVIVDLSADYRFEPSWQYGLPELNDREALRNSKRIPGCYATGSQVGL.......................................................................... 161
42 -9.130[GQ] KOG2741 Dimeric dihydrodiol dehydrogenase  ali follow..  14  1MSGDQIRIGLLSCTNKVRKLSRAINLSPNASAIATTSSIEEAKSFAKSNNFPPNTSSYESLLEDPDVVYFPIPTRLHVEWATLAAIGKHIL-LDKPVALNVAEFDQIVEACEVNGVQFMDGTPRTDKIKEF---DLESFGQIKSVYSCFSFAASDDFLKHDIRVKPGLDGLGALDAG............................... 190

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.