current user: public

If you have questions about the server, please let us know.

Query: [K] COG2101 TATA-box binding protein (TBP), component of TFIID and TFIIIB, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MSEREKITIENIVASTSLAEHLDLSRIALALDGSEYEPEQFPGLIYRLQDPKTAVLIFRSGKVNCTGAKNIEDVKRTIKIIIDKLKAANIEVYDDPDIIVQNIVAVYDLESELNLTDIAMSLGLENVEYEPEQFPGLVYRVEEPRVVLLLFGSGKVVCTGAKEESEIEQAVIKVKKELQKVGLILast
1 -83.000[K] COG2101 TATA-box binding protein (TBP), component of TFIID and TFIIIB  ali  100  1MSEREKITIENIVASTSLAEHLDLSRIALALDGSEYEPEQFPGLIYRLQDPKTAVLIFRSGKVNCTGAKNIEDVKRTIKIIIDKLKAANIEVYDDPDIIVQNIVAVYDLESELNLTDIAMSLGLENVEYEPEQFPGLVYRVEEPRVVLLLFGSGKVVCTGAKEESEIEQAVIKVKKELQKVGLI 184
2 -71.700[K] KOG3302 TATA-box binding protein (TBP), component of TFIID and TFIIIB  ali follow..  37  18.PSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHLSKLAARKYARIVQKLGFPA-KFKDFKIQNIVGSCDVKFPIRLEGLAYSHS-AFSSYEPELFPGLIYRMKLPKIVLLIFVSGKIVITGAKMREETYTAFENIYPVLREF... 195
3 -7.320[OC] KOG1672 ATP binding protein  ali follow..  14  46......................RIAALKREVEKRESFKRQGHGEYREVSEGDFLGEVTRSEKVICHFYHKEFYRCKIMDKH---------------------------------LKTLAPRHDTKFIKVDAENAPFFVTKLAIKTLCVVLFSKGVAMLVGFQDLGTKDDTTNKLENVLLKKVRE 179
4 -6.700[R] COG2823 Predicted periplasmic or secreted lipoprotein  ali follow..  14  76...........................................................QGKVLLVGQSPNAELSARAKQIAMGVDG------------ANEVYNEIRQGQPIGLGEAS-----NDTWITTKVRSQLLTSDLVKSSNVKV-ENGEVFLMGLVTEREAKAAAD-VKRVTTAFTFI 190
5 -6.640[T] KOG3170 Conserved phosducin-like protein  ali follow..  134..................................................................................................................LSGLARKFP--DVKFIKANSTTCIPNYPDRNLMVFVYLEGDIKLIGPLVFGGMNLTRDELGWKLSESRAV 204
6 -6.260[R] COG3054 Predicted transcriptional regulator  ali follow..  15  58...........................................................AGKVRVL--AGRTSAKEKNATLIEAIKSAKLPHDRYQTTTIVNTDDAIPGSGMF-IESNKKLYPWSQFIVDSNGVARNAWQLKEEGSAVIVLKDGRVQ-DGALTQQEVQQVVDLLHKLLSK.... 185
7 -6.090[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  136.........PHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHW. 324
8 -5.580[K] KOG2240 RNA polymerase II general transcription factor BTF3 and related proteins  ali follow..  14  3..........................................................................QEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASL-SANTFAITGHAEAKPITEMLPGILSQL...... 105
9 -5.490[S] COG3831 Uncharacterized conserved protein  ali follow..  1................................................................................................................MGTHHYQLYCQRIDANRNMARYYALAIRPTLFGEIAVVRSWGRIGKAGGENDNDAISRFLELVLQKRKRGY. 77
10 -5.190[O] KOG0910 Thioredoxin-like protein  ali follow..  17  117..................................................................................................................MEALSQEYGDK-VKIDHDANPKLIAEFKVYGLHFILFKDGKEVREGAITKAKLKEYIDGLLN........ 185

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.