current user: public

If you have questions about the server, please let us know.

Query: [E] COG2113 ABC-type proline/glycine betaine transport systems, periplasmic components, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310
# Score Template Links and tools%idFirst MLKQITAMTAGLLMTIGVAAAAEPESCKTVRFSDVGWTDITSTTAVASTILEALGYAPQSKLLSIPVTYASMKNKDIDVYLGDWQPSMEADRKPFLEDKSIEVIGPNLTGAKYTFAVPKYVADAGVKDISDLQKFPDKFGRKIYGIEPGNNGNRMILDMINKGDFGLTGWELVESSEQGMLAEVERATKDDQWIVFLGWAPHPMNTRYQIDYLSGADAYFGPNYGGADIYTNIRAGYAQECPNVARFVTNLRFTLEMENEIMNGILNDGNDPKDAAADWLKAHPEAVAPWLEGVTTFDGAPAKEAVESALKSLast
1 -120.000[E] COG2113 ABC-type proline/glycine betaine transport systems, periplasmic components  ali  100  1MLKQITAMTAGLLMTIGVAAAAEPESCKTVRFSDVGWTDITSTTAVASTILEALGYAPQSKLLSIPVTYASMKNKDIDVYLGDWQPSMEADRKPFLEDKSIEVIGPNLTGAKYTFAVPKYVADAGVKDISDLQKFPDKFGRKIYGIEPGNNGNRMILDMINKGDFGLTGWELVESSEQGMLAEVERATKDDQWIVFLGWAPHPMNTRYQIDYLSGADAYFGPNYGGADIYTNIRAGYAQECPNVARFVTNLRFTLEMENEIMNGILNDGNDPKDAAADWLKAHPEAVAPWLEGVTTFDGAPAKEAVESALKS 312
2 -50.000[M] COG1732 Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein)  ali follow..  13  1MTISKLWVSSLALLA---TVSLPLQAASPVTVGSKIDTEGALLGNMILQVLESHGVKTVNKIGTTPVVRGAITAGELDIYPEYTGNGAFFFKDEDAEQNKLVWLTPAPANNTWTIAIRQDIAEKKLSSLADLSRYLKEGGTFKLAASAEFERADALPAFEKAYDFTLNQNQLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPKGVQPIYAPAP----VVRESVLQAYPQIADWLQPVSLDEKTLQQLNARIAVEGLDAKKVAADYLRQK............................. 301
3 -18.900[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  10  1.....MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTFAKESGATVDWRKFDSASIVRALASGDVQIGNLGSSPLAVAASQQV--PIEVFLLASKLGNSE------ALVVKKTISKPEDL-------IGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQP----PAIIAAWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDV-WVVRKDFAEKHPEVVKAFSKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAELTGPVNK 288
4 -14.300[K] COG3888 Predicted transcriptional regulator  ali follow..  49....KRRTIGGKIKHVWLAEYYPYYDEKLLRIGCLRSTEYVKFVSVAKNYSESKGIDLIVRFYDDAILMNDLSQGLLEFAL----APIFTEIIYSISNRNSIILGAVASGGS---------------------YKNVNCNCGKILTSESSSMMILAREFAKTRKISEIAIFKDPRR-------AIKDYESFKAEYIVIWEP------YASKIMGEKMASFSDVLDSFPCCGISVSENNRENRTLIEIVR----------LYKRSRFTAREDVIDIFAKSTSVSPKTAKASLENYIIKFYRSDLKKYLEFIG. 312
5 -13.200[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  5MKKTTFTLAAASLILVSYSASSADDARIRLATTT-STYDSGLLDYLLPKFEQDTGYKVDVIATGTGKALKMGENGDVDLVM-----THAPKAEASFVEAGFGVLPRKLMYNDFVVVGPESDPAKIADEKNIAKVFENIAKSGAVFISRGDDSGTHKKELGIWAQNKIEPNFGGYRSIGQGMGPTLNMASEMQAYTLTDRGTWLA---------------------------------YNNKLALKILFEGDEQLFNPYQVIIVNPERYPTTQYHAAKVFSD--------WL---VNPKGQQLINE....... 259
6 -11.700[P] COG1464 ABC-type metal ion transport system, periplasmic component/surface antigen  ali follow..  12  10SLKSLLTIAAAASTLILAGCGEKAVDNNKVKIGVMAGAEAQVAEVAAKVAKEKYNLDVELVTFTDYVT-AALDDGSIDANAFQHKPYLDKQIAD--RGYKLAIVGNTFV-YPIAGYSKQIKSVDELQDGARIAVPNDPTNLGLLKLREDVGLLATVRD-IVENPKKLEILELDAAQLPRSLDDVALSIINTTYASSINLTPE------DGIFVENKESPY--------VNILVAREANVNAENVQNFKKAYQ--------------------TDEVAKAASEQGGAVKGW...................... 275
7 -11.600[ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain  ali follow..  12  1MKKLVLSLSLVLAFS--SATAAFAAIPQNIRIGTDP-SQGELVGDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIM--------SSLSITEKRQQEIAFTDKLYAADSRLVVAK----------SDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFG----GPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMR---------------ADGTYEKLAKKYFDFD............................. 256
8 -11.000[R] COG4134 ABC-type uncharacterized transport system, periplasmic component  ali follow..  12  1MMRHCGWLLGLLSLFSLATHASNEAKGQTVWFNA-DTAINRYLDWVSGEMKTHYAINLKIVRLADAADAVK-TGGSVDLLWENFRTLKEANLLQTDWAETLPNWRYVDTQAQLTFIARRDVTPQPPQTPQALLEFAKANPGTVTYPRPPDFTGTAFLEQLLIMLTPDPAALNEAPNDATF-ARMDALLKAGTFRLSLTFNPAHAQQKIASGDLPASSYSFGFREGMIGNVHFVTIPANANASAAXKVVANFLLSPDAQLRKADPVLDPQKLPDGQRETLQSRMPQDLQEWLHRYGT................ 388
9 -10.900[P] COG4150 ABC-type sulfate transport system, periplasmic component  ali follow..  6VKKNARNGLTHIALFSALILSGVTASATELLNSSYD-VSRELFTALNPGFQAQWKLTIKQSHAGSSKQALAILQGKADVVT----YNQITDVQILHDRGNLIPADWQARLPNNSSPFYS-VRKGNPKNIRNWDDLVREDVKLVFPNPKTSGNGRYTYLAAWGATQLADGGDEAKTRDTGGRGATTTFVERGLGDVLISFESEVNNIR-DQYEVIVPPVDILAEFPVAWVDKNVEKN--GTEKAAKAYLN---LYSPPAQQVITRFNYRVYDKAAMEAA-----EDQFGSWPQVMSTHFTTGGVDKLLAEGHQ 345
10 -10.800[P] COG0715 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components  ali follow..  10.RRKFIFTAGASASAVFLKGCEQAPEVTTVKLGYIP-----IVESAPLIIAKEKGFNVELSKQASGSARDNVEIGSAGGGIDG-HLITEGLITKGNQKIPMYVLCQLITHGNGIAIANKHQGSGIGLRLASAKSLFSKLKASPTPFTAAQTFPAVNQDFWIRYWLAAGGIDPDADVKLLTVAQTVANMKTGTMDAFSTGDPWPFRIVKD-FMAALTAEIWKNH---PEEYLAMRSDWVDQHPKATKALLK------GLMEAQQWCDNFDNRKELAERAYFNVPVDVLIDPYMGKYDMGEGRQIDDRSMAAL. 353
11 -9.310[H] COG4143 ABC-type thiamine transport system, periplasmic component  ali follow..  1........MLKKYLPLLLLCAAPAFAKPVLTVYTYD-ADWGPGPAVKKAFEADCNCELKLVAEDGVSLLNRLRMEGKNSKADVVLGLDNNLLEAATQTKLFAKSGVANEAGYFAFVYDKSKLKNPPKSLKELVESDQKWRVIYQDPRTSTPGLGLLLWMRKVYGLAAKTVTVTKGWSEAY-----GLFLKGESDLVLSYTTSPAYHIINYAAANFSEGHYLQVEVAARTVASKQPELAEKSPAFQNAIPTGNWMYPVADVALPAGFESLAKPATTLEQQVAAQRQAWSEWQRAVSR................ 327
12 -9.020[E] COG0687 Spermidine/putrescine-binding periplasmic protein  ali follow..  11  1MMKRFGKTLLALTLAGSVAGMAQAADNKVLHV---NWSD-YIAPDTLEKFTKETGIKVVYDVYDSEVLEAKLLAGKYDVVVP-----SNSFLAKQIKAGVYQKLDKSVSDPGNEHAIPAFGDNAPVDSWDLVFKPENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKKYNIPKEGAGSFFDMVAIPKDAENTEGALAFV-NFLMKPEIMAEITDVVQ---PNGNAAATPLVSEAIRNDPGIYPSEEVMKKLYTFPDLPAKTQR 354

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Godzik A. Surface map comparison: studying function diversity of homologous proteins. J Mol Biol. 2001 Jun 8;309(3):793-806.