current user: public

If you have questions about the server, please let us know.

Query: [C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380
# Score Template Links and tools%idFirst MTADPVAQRLQKRLPVPYTEWLPELIRRNVGKWVDRKFHGYGIIEPISSTGDRVFTVKVGTPPNFRMSTETLRKFIDIADKLGIGGIKITRNGNLEILTDSLDKALKIKEEVEKMGFPVGGWGRSMWGINSCTAFLTCTTAVVDSPSITKALGDALAPYFKEESLPAKLRIFVSGCPAMCAGGTAIDIAIVGQWGAPPKIREEVIGMCLPPPRALAKVTESQIFLVQVCPTGAHTLRREGDKVKLVLLGEKCINCARCKENCDAFDYDPENVGVAILVGGKMSNTGGGARLARVLIPWLPAKPPRYEEIIAVVKHVIEVWRQHAKPGERLADFIDRVGWSKFLELVGLKEVHDYYQRVPEFARTFLTFRGRGDVYKRLRDALLast
1 -116.000[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali  100  1MTADPVAQRLQKRLPVPYTEWLPELIRRNVGKWVDRKFHGYGIIEPISSTGDRVFTVKVGTPPNFRMSTETLRKFIDIADKLGIGGIKITRNGNLEILTDSLDKALKIKEEVEKMGFPVGGWGRSMWGINSCTAFLTCTTAVVDSPSITKALGDALAPYFKEESLPAKLRIFVSGCPAMCAGGTAIDIAIVGQWGAPPKIREEVIGMCLPPPRALAKVTESQIFLVQVCPTGAHTLRREGDKVKLVLLGEKCINCARCKENCDAFDYDPENVGVAILVGGKMSNTGGGARLARVLIPWLPAKPPRYEEIIAVVKHVIEVWRQHAKPGERLADFIDRVGWSKFLELVGLKEVHDYYQRVPEFARTFLTFRGRGDVYKRLRDAL 382
2 -49.400[P] COG0155 Sulfite reductase, beta subunit (hemoprotein)  ali follow..  13  297...GNRTDRKNAKTKYTLERVGVETFKAEVEKRAGVSFSAIKPYVKGVDKKWHLTLFVENGRLLD-YPGRSLKTGVAEIAKIHQGDFRLTANQNLIVAGVPEKDKARIEALAREHGLMDDNVTSQRENSMACVSFPTCPLAMAEAERFLPEFVTRVEGILQQHGADEHIVLRVTGCPNGCGRALLAEVGLVGKAVG----------------------------------------------------------------------------RYNLHLGGNREGTRIPRMYRENI---------TADEILLITDQLVGRWAKERHVDEGFGDFVIRAGVIAPVIDSARD................................. 568
3 -31.200[C] COG1251 NAD(P)H-nitrite reductase  ali follow..  15  522...........EVCKPTVGSLLASCWNEYILKPQHTPLQDTNDNFLANIQKDGTYSVIPRSA-GGEITPEGLVAVGRIAREFNL-YTKITGSQRIGLFGAQKDDLPEIWRQLIEAGFETGAYAKALRMAKTCVGSTWCRYGVGDSVGFGVELENRYK----GIRTPHKMKFGVSGCTRECAEAQGKDVGIIAT-----------------------------------------------------------------------------EKGWNLYVCGNGGMKPRHADL--------LAADLDRDTLIKYLDRFMMFYIRTADKLTRTAPWLDNLGIEYLKSVIIDDKLGLNEH----EEEMARLRAAVVCEWTETVNT. 800
4 -15.400[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  7.......................................................................................................AVAAVXLLGLAFGAILGYASEKIDEILPQSQCGQC--GYPGCRPYAEAISCN--------------GEKINRCAPGGEAVMLKIAELLNVEPQPLDGEAQELTPARMVAVIDENNCIGCTKCIQACPVDAIVGA---TRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDS........................................................................................................ 173
5 -11.900[C] COG1146 Ferredoxin  ali follow..  43.......................................................................................................................................................................................................................YDKCVTCGICFVTCGRRVFDFDKKEGKVIVARPYNCMVACQTCMNLCPTGAISFPDASYIKKLVAQNKIVKKAFEIIKPLLAEDHLSPKETETKPE....................................................................... 138
6 -11.400[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  14  8...............................................................................................................................DSTLCIGCHTCEAACSHRQHGLQSMPRLRVMLNEKESAPQL-------CHH-CEDA----------------------------------------PCAVVCPVNAIT----RVDGAVQLNESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPPAPPAPARISTLLDWVPGIRAIAVKCDLCSFDEQGPACVRMCPTKALHLVDNTDIARVSKRKRELTFNTDFGDLTLFQ................. 195
7 -11.200[I] COG0821 Enzyme involved in the deoxyxylulose pathway of isoprenoid biosynthesis  ali follow..  12  203......................................................QPLHLGITEAGGARAGSVKSAVGLGMLLAEG---IGDTLRISLAADPVEEIKVGFDILKSLRIRSRGI-----NFIACPS---CSRQEFDVIGTVNALEQRLED------VLTPMDVSIIGC-NGPGEAEVSHLGLAG.............................................................................................................................................................................................. 324
8 -11.100[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  13  2......................................................................................................SLTMRIFTASRNGQRLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNNKELSMEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERATRYDIDMTKCIYCGFCQEACPVDAI--------------------------VEGPNFEFSTETHEELLYNKEKLLCNGDKWESASNLQADHLYR.............................................. 217
9 -10.200[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  17  2...........................................................................................................................NTLFGKAKEEARVISPKSVDEYPEAPITLGTTLVNFTGDWR-TFMPVIDESKC-VKCY------------------------------------------ICWKFCPEPAIYIKED---GFVAIDYDYCKGCGICANECPTKAITMVRE.............................................................................................................. 103
10 -9.840[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  18  10...............................................................................................................................DSSRCTGCKTCELACKDFKDLGPEVSFRRIYEYAGGDWQEFAYYLSISC-NHCDDP----------------------------------------ACTKVCPSGAMH---KREDGFVVVDEDVCIGCRYCHMACPYGA.................................................................................................................... 113
11 -9.460[C] COG0348 Polyferredoxin  ali follow..  15  105...................................................................................................................................C----VCPLNIV--TDASAWLRRKLEIRQSAKLPRSLRYAILV-CGHLCPIGAA--YGVIGAKG------------LFRIKVEHRQQCDNCMDCYNVCPEPQVLRDHAKKSESPLVLSKDCISCGRCIDVCPEKVFI.................................................................................................................. 277
12 -9.430[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  12  1MKDVFYTSTRAEVTDPAKWYQPDLSAVRKLEKLID--------ESGVLDVVSKGDVVAVKTHFGRTLRSVFIRTVVEKVIEAG-GRPFVTETTGLGMLRPRCTAVGRI-NIAEENGYTHQTLKAPIIIADGLLGFDYVEVPVEGKHLNSVKVAKAIAECDAVICCTHFKLHMQAG-----------GGSIKNVGVGCVAKPSKFDIHMSDYPQIDEEKCTKCDECVKICPSNAIE--------DYQINREKCVKCLGCSEACDYGAVKTFWVFGRAYLNFLMDITPHCDCHPYSDLPVVPDLIMASKDILAIDRASVDLYRQDWTDVEGMLNYAEKLELGTQNYRLIE.................................. 361
13 -9.270[C] COG1905 NADH:ubiquinone oxidoreductase 24 kD subunit  ali follow..  14  15.............................................................PDAFELSAEERDAIEHEKHHYEAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVEGVAT--HVIRYCDSVV-CH--ITGYQGIQAALEKKLSIKPGQTTFDGRFTLLPTCCLGNCDRGPTMMID................................................................................................................................................................................................. 152

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.