current user: public

If you have questions about the server, please let us know.

Query: [R] COG2358 TRAP-type uncharacterized transport system, periplasmic component, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MSLSRRFGLFTLAATVTFSTSVFAAPTFINILTGGTSGVYYPIGVGLSQIYGHDIQGAKTSVQATKASVENLNLLQAGRGELALALGDSVADAWNGVADAGFKAPLKKLRAIGNTYPNYIQVVASQASGIKTLADLKGKRISVGAPKSGTELNARAIFKAAGLSYEDMGKVEYLPYAESVELIKNRQLDATLQSSGLGMAAIRDLASTMPITFVAIPADVVAKIDSPAYHAASIPAGTYDGQEQDVPTVAIDNILVSHSGVSDELAYQMTKLMFDNLPRLVTAHAAAKDIALDKAAKNLPIPLHPGAERFYKEKGVLPELast
1 -114.000[R] COG2358 TRAP-type uncharacterized transport system, periplasmic component  ali  100  1MSLSRRFGLFTLAATVTFSTSVFAAPTFINILTGGTSGVYYPIGVGLSQIYGHDIQGAKTSVQATKASVENLNLLQAGRGELALALGDSVADAWNGVADAGFKAPLKKLRAIGNTYPNYIQVVASQASGIKTLADLKGKRISVGAPKSGTELNARAIFKAAGLSYEDMGKVEYLPYAESVELIKNRQLDATLQSSGLGMAAIRDLASTMPITFVAIPADVVAKIDSPAYHAASIPAGTYDGQEQDVPTVAIDNILVSHSGVSDELAYQMTKLMFDNLPRLVTAHAAAKDIALDKAAKNLPIPLHPGAERFYKEKGVLPE 319
2 -19.900[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  12  1......MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTFAKES-GATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQ---------VPIEVFLLASKLGNSEALVVKKTISKPEDLIGKRIAV-PFISTTHYSLLAALKHWGIKPGQ-VEIVNLQPPAIIAAWQRGDIDGAYV-----APAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFSKSAIDAQQPYIANPDVENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAELTGPV-IDTAQFLKEQGKVPA 305
3 -16.300[P] COG3221 ABC-type phosphate/phosphonate transport system, periplasmic component  ali follow..  12  1MISRRSALVIAAGLSALALASCSGKSDTFSILSTESTQNMESYWTPILKDMEKQT-GLKVKPFFSSNYSSLIVAMGAKQTDLGWFSNQSGLEAVRNGEVFARTFDPSGTDGYKSV------IIVPADSKIQSVQDLKSLDFGIGDKKSGTLAPMTYVFIPANKKPETCFKTVISNHQANLFAVANGKLDASTNNSTAIGLSKAR-GVTDKIRVI--------------WESPTLPEDP----------------LVWRKDIDPVVKEKLRQFFLTYAQGDTPEAEQQRGYLKRLSIGG..................... 279
4 -14.700[P] COG0715 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components  ali follow..  14  8FSRRKFIFTAGASASAVFLKGCLGNPPETTGGTQSAPTAYIPIVESAPLIIKYGLTNVELSKQASWGSA--RDNVEIGSAGGGIDGGQWQMPMPHLIGLITKGNQKIPMYVLCQLITHGNGIALRLASAKSLFSKLKASTAAQTFPAVNQDFWIRYWLAAGGIDPDADVKLLTVPSAQTVANMKTGTMDAFSTGDPWPFRIVKEIWKNHPEEYLAMRSDWVDQ-ATKALLKGLMEAQQWCDNFDNRKELAEIVAARAYFNVPVDVLIDPYMGKYDMGEGRQIDDRSMAALYWKDEKGSVSYPYKSHDLWFITESGFLPK 385
5 -14.000[K] COG3888 Predicted transcriptional regulator  ali follow..  10  49.....KRRTIGGKIKHVWLAEYYPYYDEKLLRIGCLRSTEYVKFVSVAKNYSES-KGIDLIVRFYDDAISLMNDLSQGLLEFALAPIFTEIIYSISNRNSI-----------------ILGAVASGGSGVYKNVNCNCGKILT-SESSSMMILAREFAKTRKISEIAI----FKDPRRAIKDYESFKAEYIVI----P------ASKIMGEKMASFSDVL------DSFPCCGISVSENNRENRTLIEI-VRLYKRSRFTAREDVIDIFAKSTSVSPKTAKA---SLENYIWDIKFYRSDLKKYLEFIGYPPIEEIIEK 322
6 -12.700[P] COG4150 ABC-type sulfate transport system, periplasmic component  ali follow..  1MKQNSVLTHIALFSALILSGVTASATELLNSSYDVSRELFTALNPGFQAQWEQQNPGDKLTIKQSAGSSKQALAILQGKADVVTYNQITDVQILHDRGNLIPADWQARLPNNSSPFYSTMAFLVRKGNNIRNWDDLEDVKLVFPNPKTGNGRYTYLAAWGATQ-LKNVEVFDTGGRGATTTFVERGLGDVLISFE-------SEVNNIRKEYGSDQYEVIVPPVDILAEFPVAWVDKNVEKNGTEKAAKAYLNYLYSPPAQQVITRFNYRVYDKAAMEAAKSQFPDTKLFRVEDQFGS-----PQVMSTHFTTGGVLDK 338
7 -12.200[ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain  ali follow..  15  1MK-KLVLSLSLVLAFSSATAAFAAIPQNIRIGTGELVGFDIDLAKELCKRINTQCTFVENPLDAL------IPSLKAKKIDAIMSSLSIT------------EKRQQEIAFTDKLYAADSRLVVAKNSDQPTVESLKGKRVGV-LQGTTQETFGNEHWAPKGIEI-----VSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGG........................................................................................................ 204
8 -12.100[M] COG1732 Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein)  ali follow..  1..MTISKLWVSSLALLATVSLPLQAASPVTVGSKI-----DTEGALLGNMILQVLESHGVKTVNKGTTPVVRGAITAGELDIYPEYTGNGAFFFKDENDPAWKNAKQGFEKVKKLDAEQNKLVIAEKNKLSSLADLSTFKLAASAEFIERADALPAFEKAYDFTLNQNQLLS-TAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSD-----------KGVQPIYAPAPVVRESVLQAYPQIADWLQ------VFASLDEKTLQQLNARIAVEGLDAKKV-----------------------AADYLRQKGWVK. 305
9 -11.100[Q] COG4663 TRAP-type mannitol/chloroaromatic compound transport system, periplasmic component  ali follow..  14  1MDRRSFIKHASIGGLGAAAASALAAPARLTSSFPKSLDTIYGGAEVLSKYVSEATDGFQIQVFAAGPGLQAADAAAAGTVEACHTVAGMNAWHYHGGGIDLFNEFLGTQGLVGYPGGNTVQMGGWFRKEIKTVADMKGLKMRVGGFAG-------KVMERLGVV------PQQLAGGDIYPALEKGTIDAAEWVG---------PYDDEKLGFYKVAPYYYGWWEGGPTVHAMFNKAAFDGLPKAYQS-------LLRTACQATDANMLQKYDYLNPSAIKRLVA--AGAKLSPFSPEILSACFDESNKVYAEME.... 324
10 -10.500[P] COG1910 Periplasmic molybdate-binding protein/domain  ali follow..  10  111..................................................................GSLNSLIDMYQGKCDIVSLHLYDAETGQYNAPYVKRILTGEPF-CLINVVLRKAGLYVQKGNNIQGWKDLKRADIRI-EKGSGARVLLDEQLGLLGVNPADVYGDIVTDHYAAASQVSSGQADAGI--------GAQHAAHMGSVDFIPLIDEQYDIV---------VLKKNEQLLKAVKEILNSEDYKANLSHLNGYETKLTGKVILE............................................ 307
11 -9.460[P] COG1464 ABC-type metal ion transport system, periplasmic component/surface antigen  ali follow..  13  7MKFSLKSLIAAAASTLILAGCGEKAVDNNKVKIGVMAGAEAQVAEVAAKVAKEK-YNLDVELVTFTDYVTPNAALDDGSIDANAFQHKPYLDKQI-------ADRGYKLAIVGNTFVYPIAGYSKQIKSVDELQD--GARIAV-PNDPTNLGRSLLLLQQQGLREDVGLLATVRDIVENPKKLEILELDAAQLPR-------------------SLDDVALSIINTTYASSINLTPEKDGIFVENKESPYVNILVAREANVNAENVQNFKKAYQTD........................................... 257
12 -9.220[G] COG1638 TRAP-type C4-dicarboxylate transport system, periplasmic component  ali follow..  11  1MR-KLLLTTTAIAFAVGAAAPAMAEFNSRNIRVSNGINQDHPVGNGMQACLDDKSGGLKLTAFWGGGDLQATQALRSGVQEAVVTSSKEADAVMDGADMMNKKLEEQGLVNLA-YWENGFRNLSNSKHAVNKWEDFSGLKVRV------QNNIFLDTFQNLG------ANATPMAFGEVFSALETNAIDA-------PYVTIDTSKFYEVQKYVTETNHAYTPF------LFLFSKPIFDSYTPEEQT-------ALRECAVVGRDEERKVIRELNQKSLEKIKAAGLEVNSPEEQTRIREKSMVVYEKHKAEIG.... 318

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Godzik A. Surface map comparison: studying function diversity of homologous proteins. J Mol Biol. 2001 Jun 8;309(3):793-806.