current user: public

If you have questions about the server, please let us know.

Query: [S] COG2410 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MYCGIDVGLKKCHAALISDRLEFVGDYTELDLDNVRVTGIDAPLSFPAKGSLRECERLLLKMGIRLFPSGAPFFRGIALRGMEIAEELRSKGVEVYEVYPYATRVILNIAPKAKKHTKSGLEEIRAELSRWVEIPELSHDEVDAVIAALTVKLFSEGMGVKLEGIDGSIVVPKGRVQLSLNPLast
1 -93.500[S] COG2410 Uncharacterized conserved protein  ali  100  1MYCGIDVGLKKCHAALISDRLEFVGDYTELDLDNVRVTGIDAPLSFPAKGSLRECERLLLKMGIRLFPSGAPFFRGIALRGMEIAEELRSKGVEVYEVYPYATRVILNIAPKAKKHTKSGLEEIRAELSRWVEIPELSHDEVDAVIAALTVKLFSEGMGVKLEGIDGSIVVPKGRVQLSLNP 182
2 -52.800[S] COG4328 Uncharacterized protein conserved in bacteria  ali follow..  15  9SIVGFDSAWAPGAICVIRLDGDGAHLYRERKEAQKCLVALDQPTIVPNLTGSRPVDRVAGSLGVQPASRSKKGMFDDGAPIWRFKQTLASSGLFLIEVFPALALAAIEGTFCSRLAAPKYKISDWQAVAEAVRPRKADQDKVDALICGLIGLHWLAAQSVMIGDESGYMIAPATRGVHE... 260
3 -45.100[S] COG4923 Uncharacterized conserved protein  ali follow..  17  5VFVGVDGCRAGWFVVFFGGGNCLVDFLKNNYEQVDPLILIDIPIGLKGGSGERLSDLGARSRKSSIFPVPCREAKRISKQAWNIVPKIRDVDGKVREVGPEICFQAFGFPMKYPKKKDEGFLERKEVLDNVRRKDLSKDDILDALAAALTAQMGGICGFTYVPDSKGLMVYCECEKVRS... 255
4 -13.600[L] COG0817 Holliday junction resolvasome, endonuclease subunit  ali follow..  14  3IILGIDPGSRVTGYGVIRQAGRHLEYLGS------VIRTSVTDLPTRLKRIYMGVNEIILQYQPDMFAIEEVFLAKNANSALKLGQAAVNHDLPVFEYAARLVKQTVVGIGSADKIQVQDMVTRILTLSE-----KPQADAADALAIAIT................................ 149
5 -9.090[S] COG5323 Uncharacterized conserved protein  ali follow..  12  265IVVAVDPPASSGKVAGIDAEGVGHRAIALYHTHEADAIVAEV------NQGGEMVAAVLAAEDPSVPVLKRRASRGKWLRAEPVAALYEQGRVRHAGRFPALEDEMCDFAPEGLSSGR-------------------SPDRLDALVWALGELMLGADHKPRIRR--G............... 430
6 -9.070[R] COG5362 Phage-related terminase  ali follow..  12  13SAQSWDMAFKDT-------KKSDFVAGHVWNRKKADFFFIDR---IHDRMGLPETLNAVRRLTIK-HPLAIAKYIEEKANGPAVMQTLKGEITGMIGVEPETPLFESGNVYFPHPLYAPWISDVIEEMLAFPNG--EHDDDVDAMTQALV................................ 159
7 -8.870[R] COG4373 Mu-like prophage FluMu protein gp28  ali follow..  12  348FSFGEDFARTGDLSCFVLAQQEQVMMYILTRVPALVGAAFDA-----TGNGGYLAEAALLAFGPDIIDCVMLSPKWYGEWMPKLKAEFEDQNILV----ARHQTTLDDLRHVKVVNGIPQIDKGRTKDQNATAVNARRHG--DFAVALCMANRASYMEGFILDESA................ 524
8 -7.960[L] COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B. subtilis)  ali follow..  11  5.LLAFDFGTKSIGVAVGQRITGTARPLPAIKAQQPDEIIVGLPLNMDGTEQPL------------------------TARARKFANRIHGRFGVEVKLHDE----------------RLSTVEARSGLFEQGGYRALNKGKIDSASAVIILESYFEQG........................ 137
9 -7.470[R] COG5565 Bacteriophage terminase large (ATPase) subunit and inactivated derivatives  ali follow..  15  303QIGGLDFGWDHPFAAVWDRDADVFHVTKIYREREATPWAWPHDGLQHDKGSGEQLAAQYRAQGLALLPERATFDDGTNGVEAGLSDMLQRMQSGRWKVFSTC---------------TEWFEEFRLYHRKDGRIVKERDDLISASRYALMMKRHARAN........................ 463
10 -6.950[L] COG1039 Ribonuclease HIII  ali follow..  78.LIGTDEVGNGSYFGGLMVTASFVS---EENLNFLKEIGVADSKKLTDEKICQIAPKLIDRIPHVALVVEPAKYNEVIASGYNAVSIKVALHNQAIYLLEKQL-ENIVIDAFTTEANYKKYVNKEQNHPLTKVTLLTKAEDQFLAVAVIISRYLFLENLKKLSKESGF.............. 246

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.