current user: public

If you have questions about the server, please let us know.

Query: [R] COG2521 Predicted archaeal methyltransferase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MGYVAVPVVSKWQIEDLLTKRGEVSFDLEISKTVVEYRGGVARFQYNGVLYEIELDSLPEVDEESCEVYALIGGEWRELSIAADRFYKLCVFNRGWAPTLMIDGITMHSVLENPLLLTSRKVERAWGRVFECCTGLGYTAIEALKKGARHVITVEVDPHVLTLASLNPYSRGLWSPAVDVILGDCYAFVQTVRDSSIDFIIHDPPRLSHATQRLYSEALYREFYRILKRGGGVFHYVSQSGTKYRGLNPYKGVAERLRRVGFAVEKIKEGYGIYARRRLast
1 -93.700[R] COG2521 Predicted archaeal methyltransferase  ali  100  1MGYVAVPVVSKWQIEDLLTKRGEVSFDLEISKTVVEYRGGVARFQYNGVLYEIELDSLPEVDEESCEVYALIGGEWRELSIAADRFYKLCVFNRGWAPTLMIDGITMHSVLENPLLLTSRKVERAWGRVFECCTGLGYTAIEALKKGARHVITVEVDPHVLTLASLNPYSRGLWSPAVDVILGDCYAFVQTVRDSSIDFIIHDPPRLSHATQRLYSEALYREFYRILKRGGGVFHYVSQSGTKYRGLNPYKGVAERLRRVGFAVEKIKEGYGIYARRR 278
2 -54.100[E] COG0421 Spermidine synthase  ali follow..  15  10..........................................LIKDGWFREINNMWPGQAMTLKVKKVLYAGKSKYQDVLVFESETYGHVLVLDGAIQATERDEFSYQEMIAHLALNSHPNPK----KVLVIGGGDGGVLREVVKHEVEEAILCDIDEDVIKVSKQYLPSAGFNHPKVKVHIGDGFKFLQDYQN-TFDVIITDSSDPDGPAEALFQKPYFQLLSDALRGGGVI---TTQAECMWIHLGVISNVLTAVKTVFPNVRYAYTTIGFVVASK 248
3 -51.900[E] KOG1562 Spermidine synthase  ali follow..  15  1.............MNKLHKGWFTEFSPDDLEKMNGASDEEPTKVLKSDGQEMGGAWPGQAFSLQVKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAHLPMFAHPDPK----RVLIIGGGDGGILREVLKHEVEKVTMCEIDEMVIDVAKKFLPSCGFSHPKLDLFCGDGFEFLKNHKN-EFDVIITDSSDPVGPAESLFGQSYYELLRDALKEDGIL---SSQGECPWLDMKLISTVIHSARDLFPVAKYAVGSMGYILCAK 268
4 -48.600[R] COG4262 Predicted spermidine synthase with an N-terminal membrane domain  ali follow..  22  215...............................................GFAASDRLTHWSERALFGDEIIHAISSPYQRLVVTRWKDDLR-LYINGNLQFSSRDEYRYHEALVLPALESVRGAR----RVLVLGGGDGLALRQILKYPVEHVTLVDLDPRMTSLFSHAEAQHAFSDPRVTVVNADAGQWLQT-AADMFDVAIVDFPDPSNFSGKLYSVPFYRLLSRHVADTGLVVIQAT---SPYFAPRSYWCVDATLKEAGYRTWPYFGEWGFILAAP 449
5 -23.800[J] KOG3420 Predicted RNA methylase  ali follow..  13  31............................................................................................................ELAVSMMEMIDETIGFEGKKLIDIGCGCGMLMTTAATMELETVLGVDIDDEALKICSRNLETAEVQD-RCELLQADILDPESDLPRGTFDVAVINPPFGTKNNAGI-DMQFVQIGLQMVRPGGSVFSLHKSSTRDYILKNAKKWDGVGAECCAEMRWQLPATYKFHKQKA 199
6 -21.900[R] COG4123 Predicted O-methyltransferase  ali follow..  18  30...........................................................................................................FSYSVDSVLLSRFPRFPKKGLIVDFCAGNGAVGLFASTRTQAQILSVEIQERLADMAERSVRLNGLEE-QMQVICDDLKNMPAHIQGSKVDMILCNPPYFKVNPYSNLNEEICRSAQSILKSNGRLAM--------VHRPDRLLDILDTLKRHNLAPKRL........... 196
7 -21.900[R] COG1568 Predicted methyltransferases  ali follow..  11  120.................................................................................................PLHQYDQAYV-ETTVARVILMHTRGDLENKEIFVLGDDDLTSVALMLSGLPKRIAVLDIDERLIKFIEKVADELGYND--IEIFTFDLRKPLPDYALHKFDTFITDPPETIKA-----IRAFVGRGIATLKGPRCAG-YFGITRRESSLDKWREIQRLLINEFNVVITDIIRNF....... 286
8 -21.000[R] COG1092 Predicted SAM-dependent methyltransferases  ali follow..  16  193....................................................................VLHGELPPKSVVIEENGVKISVDIVGGHKTGFYLDQRDSRFQSMK----------VKEKEVLNCFSYTGGFGLYALKGGAKRVINADVSQPALDTAKFNAELNGFDISRAVFLNADVFKLLREYQGTRFDVVVMDPPKFAESKAQLDGKDINMLAMQILNPGGTLL--TYSCSGLMDQVLFQKIIADAALDAGRDVK............. 387
9 -21.000[A] KOG1975 mRNA cap methyltransferase  ali follow..  13  111.......................................................................TANRSINVDQIVREHYNERTIIANRAKRNLSPIIKLRNFNNAIKYMLIDKYTKPGDVVLELGCGKGGDLRKYGAAGISQFIGIDISNASIQEAHKRYRSMRNLDYQVVLITGDCFGE--PDCRFPCDIVSTQFCLHYAFETEEKARRALLNVAKSLKIGGHFFGTIPDSEFIRYKLN-FETLRSLADEYGLELVSQMPFNKFFVQEI 380
10 -21.000[R] KOG1271 Methyltransferases  ali follow..  13  6.......................................................................NGSELGTKEFWESSYNREIRNYKSHGDVGEIWFDESAQWRTIDWLLNEEKIDKEASRVLDLGCGNGMFLVGLANEGFTDLTGVDYSPKAVELAQNIAEDNKL---SITYKVADLTQP--QNELGQFDVVHYDAVSLCPDNAKEKRALYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPTFKFGGKVGIVFKRK 217
11 -20.700[E] KOG2352 Predicted spermine/spermidine synthase  ali follow..  13  388......................................................VEEVTVEGNQTRRLVFLNTMNLVQSEAYLKTGKKKQTVIDLDQLACDFHRMMIGSLAISPQQPLAKN--DAQCKMAVLGLGGGLLTAYLVRHKKAHVTAVELDPEVLKIANSHFSFPH-SDARIDVVIQDALIHLQETEEEKYDVIFVDVSGSQNAASAFLTPEALGNMKNSVKEQGMISLNLVTRDS-----EFGKSIKKNIAEY.................. 595
12 -20.400[L] COG0742 N6-adenine-specific methylase  ali follow..  17  5.......................................................................NHSGSGQIRIIGGQWRGRKL------PVPDSPGLRPTTDRVRETLFNWLAPVIVDAQCLDCFAGSGALGLEALSRYAAGATLIEMDRAVSQQLIKNL--ATLKAGNARVVNSNAMSFLAQ-KGTPHNIVFVDPP---------FRRGLLEETINLLEDNGWL............................................. 148
13 -20.400[R] KOG2899 Predicted methyltransferase  ali follow..  14  109............................................................................................................................RNKQLLDIGCNSGHLSIQIARKEVKSLVGLDIDRGLINDAQKTVSHLKRHAVHGNYVLEDDVLL--EIERPQFDVILC--------------KQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKLSVSFIRRSPEVGFAEMKL........... 302
14 -20.200[J] COG2263 Predicted RNA methylase  ali follow..  18  19.................................................................................................PELELEQYQTPSPLAAEILHFAYMQGDLDESVQDLGCGTGILAIGAKLLGARKVVGYDTDPKALEVARKNAERLGV---EVEFVCSDIKKV-----SGHVKTTLMNPPFGARVKGR------RPFLSSALRTSEVIYSIHNRGSLAFIQKFIKPAVITHSYVAKFPLKRTFD......... 177
15 -19.400[IR] KOG1269 SAM-dependent methyltransferases  ali follow..  16  101......................................................................................................KGEAFAQSIARHEHYLAYRMGKPGSRVLDVGCGVGGPAREITEFTGCNLVGLNNNDYQISRCNNYAVKRNLDK-KQVFVKGDFMHM--PFEDNTFDYVY--------AIEATVHEGVYGEIFRVLKPGGVFGVYE-EVGDGIPQMVRKCDAVEAIKKVGFNLLEEDD......... 281
16 -19.000[J] COG1889 Fibrillarin-like rRNA methylase  ali follow..  13  1..............................................................MSIEVVEVKPHERHYGVYVVKFEDGTERIATKNLTPGRRVYGERLSKLAAAILNGLKLVPIKEGTHILYLGAASGTTPSHISD-ENGLIYSVEFSPRVFREFMEKLVDQGRRN--VVPILGDARF-QYAHYVKGVDVVYIDVAQPAQA------KILADNADYFLKPGGMLVIKAMSIDVTAPATETFKQEINTLKERGFDILETVHLAMVIAKKR 235
17 -18.800[J] KOG3191 Predicted N6-DNA-methyltransferase  ali follow..  13  15................................................................................SMPTPQYRLQAIRAHDVYEPAEDTFLLIDAIEK---DIKEIRSRDPKLVLEIGCGSGVVSTFVNQAGNVTSVATDLNPHALDVTLETAKLNDI---KIDVVRTDLFAGLENLLGK-VDVLLFNPPYVPTDEEPKSNDRLLPRVPELLSPRGVFYLVALHSNDI--------PALLKEHSEQMTVSVSME......... 205
18 -18.200[R] KOG1541 Predicted protein carboxyl methylase  ali follow..  14  46...........................................................................................................................QPCSFILDIGCGSGLSGEILTQEGDHVWCGLDISPSMLATGLSR-------ELEGDLMLQDMGTGIP-FRAGSFDAAISNADTSYNDPKQRL-MRFFNTLYAALKKGGKFVAQFYPKND-----DQVDDILQSAKVAGFS............... 179
19 -18.100[R] COG4106 Trans-aconitate methyltransferase  ali follow..  11  29...........................................................................................................................ERVLNGYDLGCGPGNSTELLTDRGVNVITGIDSDDDMLEKAADR--------PNTNFGKADLATW-----AQKADLLYANAV----------HLAVLSQLMDQLESGGVLAVQMPDNLQEPTHIAMHETADGGPWKDAFS............... 155
20 -18.000[R] KOG2361 Predicted methyltransferase  ali follow..  13  89...........................................................................................................................SGKSVILEVGCGAGNTIFPLIATYPDFVYACDFSPRAVELVKAHDEYTETRCAFACDLTGDGLDK--HISPSSVDIVTMIFVLSAVSPEKM--SSVLQNIRKVLKPNGCILFRDYAVGDLAQERFS-EFLETLFSEQGFEVEELDVCCKQVENRS 264
21 -17.900[I] COG3963 Phospholipid N-methyltransferase  ali follow..  13  51...........................................................................................................................HSGLPVLELGPGTGVITKAILARKPESLTAIEYSTDFYNQLLRS-------YPGVNFVNGDAFDLLGEHKGQMFDSVISAVPMLNFPMAA--RIKLLDELLKRVPHGRPVVQISYGPISPIVAQPHLYHIRHF...................... 179
22 -17.700[J] COG2813 16S RNA G1207 methylase RsmC  ali follow..  12  218........................................................................................................FSRTGLDIGARFFMQHLPENLEGEIVDLGCGNGVIGLTLLDNPQAKVVFVDESPMAVASSRLNVETNMPEADRCEFMINNA---LSGVEPFRFNAVLCNPPHQQHALTDNVAWEMFHHARRCLKINGELYIVANR------HLDYFHKLKKIFGNC--TTIATNNKFVVLKAVK 383
23 -17.700[R] COG4122 Predicted O-methyltransferase  ali follow..  12  61.............................................................................................................................AKKTLEVGVFTGYSSLIVALAAEGKLVACDINEEFTAIAQRYWQKAGVDH-KIDLYLAPALETLDKLEAETFDFAFIDADKSNYD-------NYYERSLQLIRSGGVIAIKVADPEIQDNRTQKIRAFNHKLQDQRITLSLIPIGDGLTLVRK 219
24 -17.600[J] COG2890 Methylase of polypeptide chain release factors  ali follow..  19  134..........................................................................................................................TEEPTRIMDLCTGSGCIAIACANAPEAEVDAIDISVDALNVAEQNIQDHGLEQ-QVFPIRSD---LFRDLPQEQYDLIVTNPPYVDQPELGLAARRILANAPLYLKENGILVCEVGNSMV---------HMMEQYPHIPFTWLEFENGGH...... 292
25 -17.300[Q] KOG1663 O-methyltransferase  ali follow..  13  92.............................................................................................................................AKNTMEIGVYTGYSLLATALAEDGKILAMDVNRENYELGLPIIEKAGVAH-KIDFREGPALPVLDEINHGTYDFIFVDADKDN--------INYHKRLIDLVKIGGVIGYDAPMRKYVRYYRDFVLELNKALADPRIEICMLPVGDGITICRR 257
26 -17.200[H] KOG1270 Methyltransferases  ali follow..  13  69..........................................................................................................IRDNLLKTIPNHQPGKPLLGMKILDVGCGGGLLTEPLGRLGAS-VIGIDPVDENIKTAQCHKSFDPVLDKRIEYRVCSLEEIVEE-TAETFDAVVIDL------------ETFLQCCCQVLKPGGSLFITTINKTQLSYALGIVETLESILESNGLSVQTV........... 245
27 -17.100[J] KOG2915 tRNA(1-methyladenosine) methyltransferase, subunit GCD14  ali follow..  20  245...........................................................................................................................NPGDTVLEAGSGSGGMSLFLSKGSQGRVISFEVRKDHHDLAKKNYKHWRDSWDNVDFIHKDISGATEDIKSLTFDAVALDMLNP----------VTLPVFYPHLKHGGVCAVYVVNITQ-------VIELLDGIRTCELALS............. 381
28 -16.800[H] KOG1540 Ubiquinone biosynthesis methyltransferase COQ5  ali follow..  15  92.........................................................................................................LWKDHFINKLDAGKRPNSTTPLNFIDVAGGSGDIAFGLLDHAESTMDIVDINPDMLKEGEKRAMEQGKYFPRVRFLVSNGEK-LEEIDSDSKDIYIRNFTDIQKG---------LNTAYRVLKPGGIFYCLEFSKIENPLMDFAYQQWAKVLPVMGSMIANDYDSYQYLVES. 267
29 -16.400[R] COG0220 Predicted S-adenosylmethionine-dependent methyltransferase  ali follow..  18  42................................................................................................................................HIEVGCGKGFITGMAALHPEINYIAIDMQLSVLSYALDKAIEADLPN--VQMMLVDGAALSEYFADGEIDQVYLNFSDPRHEKRRLTYKSFLATYEKILRPEGEIHFKTDNR-------GLFEYSLVSLANYGMELK............. 174
30 -16.200[J] COG2264 Ribosomal protein L11 methylase  ali follow..  18  138.......................................................................................................GTGTHPT-TALCLEWLDSLDLQDKTVIDFGCGSGILAIAALKLGAKSAVGIDIDPQAILASRNNAEQNGVAD-RLQLFLSEDKP-----ADLKADVVVAN-------AGPL--KELYPVIRQLVKPNGVLGL----SGILATQASSVCDAYA--QSFVLEPVEEREEWCRITGKL 292
31 -16.200[R] COG3897 Predicted methyltransferase  ali follow..  23  75............................................................................................................................CGKRVLDFASGSGLVAIAAAKAGAAKVLAADIDPWTETAIRLNAALNGV---DIGFTGLDLVG-----KPVDADVLL--------AGDVFYDRAFADLLVPWFEKGMIVL--VGDPGRAYLPKERLRAEAT....................... 191
32 -16.100[R] KOG2904 Predicted methyltransferase  ali follow..  16  183............................................................................................................ELIVDMVEELVTRDEWFKKIWADLGTGSGAIAIGIAKVSRGRVIATDLSPVAIAVAGHNVQRYSLEG-MIEVREGSWFEPLKD-LEGKLVGLVSNPP-PSDDIPGLQAEDSLFHLCRMLQPGGFFVFETNGEKQ---SKMIVDYMMTSDLKDCFSDLKIVSDFAFVTGFR 376
33 -16.000[O] COG2518 Protein-L-isoaspartate carboxylmethyltransferase  ali follow..  26  58............................................................................................................QNMLPPRVEARVLQERKHEDVLEVGAGSGYMA-ALLAHRGRHVTTVDIAPELVAFARDNLARNGVTN--VDVVQGDAGQ---GWGNSLYDVICVSGSVPAVP----------ESLLAQLKVGGRLSIFVGSAPV.................................... 178
34 -15.800[L] COG1041 Predicted DNA modification methylase  ali follow..  18  176........................................................................................................................NLTKATREVLDPFMGTGGMLIEAGLIGLK-VYGLDIREDMVEGAKINLEYYGIRD--YVVKVGDATKIEEVFPGKTFEAVATDPPTLPMDRNELY-KRSLESIHSVLEGRLAIAF------------PADFDARDVAESIGFKVLG............ 310
35 -15.800[R] KOG2940 Predicted methyltransferase  ali follow..  17  79..........................................................................................................FVDAVADNLLDRLEDCKKSFPTAFCLGGSLGAVKRLLRGRGIEKLIMMDTSYDMIKSCRDAQDDSLDNSIETSYFVGDEEFL--PVKESSVDLIISDLP------------GSMIQCKLALKPDGLFLAAILGGETLKELRIACRDAGNLLTRAGFSVVKYKRAMDLIEHLR 275
36 -15.800[J] COG2519 tRNA(1-methyladenosine) methyltransferase and related methyltransferases  ali follow..  20  92...........................................................................................................................SPGDFIVEAGVGSGALTLFLANGPEGRVVSYEIREDFAKLAWENIKWAGFDD-RVTIKLKDIYE---GIEEENVDHVILDLPQP----------RVVEHAAKALKPGGFFVAYTPCSNQ-------VMRLHEKLREFKDYFM............. 215
37 -15.700[S] COG1255 Uncharacterized protein conserved in archaea  ali follow..  11  13............................................................................................................................KKGKVIEVGIGFYTRIAKRLKELGFDVLAIDINKDAVVNAK---------NSGLNAEVDDIFN-PNISLYMGAKAIYSIRPTPEMM-------NYILKISKAVKVPAYIVPLTGDPVP.................................... 113
38 -15.700[R] COG4076 Predicted RNA methylase  ali follow..  20  1...................................................................................................MRFRVTPYHGNLLGDHERLAA--SRARGLTYDLGAGSGILSFFASEYAD-RVIAIERDPKIAACAGENLSG----LDNVSVVNED----ALHYEFSAADTIICEMLDTALIDEEQV--PVLRRALKFLRNDGTVI............................................ 128
39 -15.400[R] KOG4300 Predicted methyltransferase  ali follow..  14  313.........................................................................................................................LVGKAEKVLEIGIGTGPNFKYYTDIPNVSVIGIDPNAKMESYARKSATEAGLKPEEFTFVHALGESI--PLEDASVDAVVGSVTDVTQT---------LKEIKRILRPGGIFIEHVAAEDGTFLGCHLTRHTGESILEARFNGGADVK......... 472
40 -14.900[M] COG2230 Cyclopropane fatty acid synthase and related methyltransferases  ali follow..  13  133.............................................................SSSNIKSHYDLSGELYDLFLDPDKQYSCAYFDPPNATLAEAQLAKKRHIAAKMLV-------KEGDKVLDIGCGWGGMGLYLARHLKANVTGVTLSEEQHAIANQRARDEGLAD-RAKFELTDYRNI-----NDKFDRLVS---GMFEHVGVGHFAEYFQHVARLMKPDGVFLLHAIGRSDGPGATNALSEVLPHIEKAGLYVTDIEI......... 339
41 -14.800[R] KOG3115 Methyltransferase-like protein  ali follow..  10  84................................................................................................................................IVDIGCGYGGLTVALGPFPDTLVLGMEIRMQVSDYLKEKIQALRYRAKNISVLRMNCQKFLPNFEKGQLSKMFFCFPDPRKHKNRIITSTLASEYAYFIRPHGTLYTITDVEELHVWMAQHLDA.......................... 223
42 -14.800[R] KOG3010 Methyltransferase  ali follow..  16  32...........................................................................................................................QDHKFAWDVGTGNGQAAIGLVEHY-ENVVATDINEAQLQRAIKHS-RISYHHTPTTISEDEMVDL--LGGENSVDLIVA-----AQAVHFFDLNVFYNVAKRVLRKEGGLIAV.......................................... 135
43 -14.700[H] COG2226 Methylase involved in ubiquinone/menaquinone biosynthesis  ali follow..  18  62...........................................................................................................................RRGQTVLDLAGGTGDLTAKFSRMETGKVILADINDSMLKMGREKLRNIGVIG-NVEYVQANAEAL--PFPDNTFDCILRNVTEKEKA---------LRSMFRVLKPGGLLVLEFSKPIIEPLSKAYDAYSFHILPRIGSMVANDADSYRYLAES. 211
44 -14.700[R] KOG1331 Predicted methyltransferase  ali follow..  24  47...........................................................................................................................SAGSIILDVGCGEAKYTSQKSH-----VIGFDTCSEVLSSSKK---------DDIDLCLADAINI--PIRDDSVDAIIHHLATTARRRQVL------QECSRCLRIGGQMLIYA......................................... 143
45 -14.500[H] COG2242 Precorrin-6B methylase 2  ali follow..  17  69...........................................................................................................................KEESIIWDIGAGTGTIPVELALLCPRRIVAVERDEEVAGLIRRNCERFGV--TNVTVHEGSAPDCLPQ---------LIAHPTHICIEGGRPIKQILQETWAHLAPGGRLVATA-------NNLESLYGISETLSELQVRNVEVVQ......... 197
46 -14.500[R] COG2520 Predicted methyltransferase  ali follow..  15  72.....................................................................LEGEHRVARFELLSGDSAETLHRENGYTYRMDIRKVFFNPRLYWERARVASKVLP-GESVLIPFAGVGPFVLPSAGKG-AAVCAIEINPDACACLKENVRLNRLEG-QVTVIQGDAEYILSHPDSNGFDRAIVPTPY---------MDHFLGEVSGNVRKEGKIHFYTFKTDS.................................... 243
47 -14.300[H] COG2227 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase  ali follow..  20  29..........................................................................................................LHDINPLRVNWIDERAGLAGKKVLDIGCGGGILSEAMAQRGAS-VTGIDMGEAPLAVARLHQLESGV---AVDYRQITAEQMAEE-MPGQFDVVVPDP------------ASVIRACHRLVKPGGQVFLST......................................... 150
48 -14.200[R] COG4976 Predicted methyltransferase (contains TPR repeat)  ali follow..  14  135...................................................................................................................VIGRVNGGGRFRHVTDLGCGTGLFG-ERIRDRADFLEGFDLSANMLAKAEAKGVYDRLAQADLSLAPEDSGVFG-ALEQRRADLVS--------AADVLM-EGVFVIADRLLAPGGLFAFSVEDARPSLRYAHPEASIASLCKESGLSMIATERT--LFLACK 310
49 -13.700[R] COG4798 Predicted methyltransferase  ali follow..  14  93...........................................................................................................RDAARRPGEILAMAELKPGDTVVDYIMGGGYFTRIISGAPQGVVYAYQPAEFIRFAARYGESLKAVTAANSKPLDGPITAL-----PDNVDAVIHDMHLKPFPTDT--AAKANAEIFKSLKPGGVFLV-SGITAADTLHRIDIAAVKQEVEAAGFKLEAESG......... 265
50 -13.700[R] KOG2920 Predicted methyltransferase  ali follow..  15  187............................................................................................................................AGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDVTLPNVVANSTLEDKCRFFSGEWSEFCKLVLSVKYDLIL--------TSETIYNPDLHQTFLRLLSKNGRVL--LASKAHYFGVGGGVHLFQKFVEERDVFKTRILKI........ 354
51 -13.400[A] KOG3045 Predicted RNA methylase involved in rRNA processing  ali follow..  15  210..........................................................................................................................IPKTAIIGDFGCGEGKLAQSV----PNKVYSMDLVAA-----------------RSDIIACNITDT--PLQARTLDVAVY-----CLSLMGTDLNEFFLEANRVLKLHGTVYI-----AEIQSRFQDVREFVRCLNACGFDLNK............ 320
52 -13.400[R] KOG2730 Methylase  ali follow..  19  351............................................................................QRYRLFSRLDQGIIMDREGWFSVTP-EAIAEHI--------ADRVVRNNVSVVVDAFTGVGGNAIQFALRG-AHVIAIDMDPVRLKCARENARVYGVEN-YIDFICADFFDVAATWQADKVDAVFLSPPGPSYLKAKEFDIDIFDVSLKILPRNTKVSQLVELATKAKSRMEIQSALNSKIKTI----------YGKLAYRE 558
53 -13.300[J] KOG2198 tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily  ali follow..  14  273........................................................................................................FMMDGASTLPPLFLQVKP---GERVLDACASPGGKSLLMLQ-HLDHLVCNDIQESRLNKLRKVMQEERWAGKRLILSQSDARNL----QYEQFDKILVDVP--NEQDNNIFKPGILANCLRLLRPGGSLV-YSTCSLSPIQNDGVVHMALQKVFTE.................. 448
54 -13.300[J] COG2265 SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase  ali follow..  11  87............ELIAVAAQSAELRNRWYAVEFLSTLSGEMLVTMIYHKRLDDEWMQAAQALQQQLDTSVIGRSRGQKIVLKQDYVTETLKVGNRDFRYRQIEGGFTQAVCQKMLEWACGAAEGLGGDLLELYCGNGNFTLPLSEK-FERVLATEISKTSVGAAQWNIEANGIGN--IKIARLSAEEFTEAYTGKAFSTIFVDPPR----------AGIDEETLKLVSQFDNIIYISCNPETLRANLDTLVETHVVERAA-FPFTHHIESGVLLKKK. 360
55 -13.300[L] COG0270 Site-specific DNA methylase  ali follow..  13  44.................................................................................................EPEAVENYLNRTKENYPVDRTTQENHHQAVKAISFFSGAMGLDLGFEKAGIEILLACEVDKYCRQTIVANKPDIALLGDIAAYSAQDILDHA-NLAKEDVDIMLGGPPGFKDERGNIFLK--YIELILQIRPKYAVIENVAPLSREEMPGGALKYIVDELRKGGYSILYNTANYGVPQIRE 255
56 -13.100[O] KOG1661 Protein-L-isoaspartate(D-aspartate) O-methyltransferase  ali follow..  13  79...........................................................................................................................QPGLSFLNLGSGTGYTMVGLILGPFGINHGIELHSDVVEYAKEKLESDKFEFCEPAFVVGNCLQIASD--SHQYDRIYCGAGVQKDHEN----------MKILLKVGGILVMPIEDQLTQIMRTGQNTWESKNILAVSF................ 216
57 -13.100[OKT] KOG1499 Protein arginine N-methyltransferase PRMT1 and related enzymes  ali follow..  18  223....................................................................................................SYAGNDIHFLMLNDSVRTEGYRDFVYHNVLDVGCGTGILSMFCAKAGAKKVYAVDNSD-IIQMAISNAFENGLAD-QITFIRGKIEDI--SLPVGKVDIIISEWMGYALTFESMIDSVLVAR--RFLAPSGIMA............................................ 359
58 -12.900[R] KOG2497 Predicted methyltransferase  ali follow..  15  170............................................................................................................................ANKACFEVGSGVGMVGICLAHVKAKEVILTDGDLLTLSNMKLNLERNHLNSTRVKCTHLPETASESELSQYRPDIVL--------GADVIYDPSCLPHLLRVLV---ALLKNPPKRASVIRNVDTFNVCLTLADQMDLSITDV........... 339
59 -12.800[L] KOG2671 Putative RNA methylase  ali follow..  12  197..........................................................................................................LGPTAMDAEMAANQAKATSGKLVYDPFVGTGSILVSAARFGA-MTMGADIDIRVVRDGRGPDCNVWSNPMPVALLRMDNNVPWRSGLKEIFDAIICDPPTGAYSLVECVH-DLLHLAARMLVMKGRLVFFFPVLRDETGSEVKFPE-HPCFKLVAVSEQILSSRYSLLTMVK 413
60 -12.800[G] KOG2798 Putative trehalase  ali follow..  15  185..........................................................................................................................ELKDIKILVPGAGLGRLTYELACLG-YSCEGNEFSYFMLIASNFVLNLCDNENKHFEIAAGDFLEV--YKTPNAYNCVAIDCAN----------IDFIRTIYKILVPGGIWVNHFSDVSGQNSIEPAFEDLCIIMESVGFVIEKEYQSLFWVCRKP 395
61 -12.800[D] KOG0822 Protein kinase inhibitor  ali follow..  13  377.................................................................................................NTFEQDQIKYYGEAVVGALKDLGADGRKTVVIYLLGGGRGPIGTKILKSEREKLYIVEKNPNAI-VTLKYMNVRTWKR-RVTIIESDMRSLAKDRGFEQPDIIVSELLGSFGDNELS--PECLDGVTGFLKPTTISIPQKYTS-KPIMSTHIHQTIKAQ...................... 551
62 -12.600[K] KOG0919 C-5 cytosine-specific DNA methylase  ali follow..  10  4...............................................................................................................................IVSSSIMIHAKLIYTFEDAQLQIVAALDVNTVANAVYAHNYGSNLVKTRNIQSLSVK------EVTKLQANMLLMSPPDTEDKRSDAL-THLCGLIPECQELEYILMENVKG----FESSQARNQFIESLERSGFHWREFITQFNVPNTRY 159
63 -12.400[R] KOG1227 Putative methyltransferase  ali follow..  15  141.................................................................................ERTPHVDLLLGADAWVDYVDERGIKFCKRVFENSKKAEMKWSCQGQTIVDMYASLGYYTLTFLVSCAKQVVAIDWNDEILESLIRSAQVNNVDD-RLLVIHGDCRRVCPD---QTADRVYLGLLP---------CRAHWLAACKALKPEGGIVHI.......................................... 292
64 -12.300[A] KOG2793 Putative N2,N2-dimethylguanosine tRNA methyltransferase  ali follow..  11  69............................................................................................................................RRRRGIELGTGCGVAGMAFYLLGLTEIVLTDIAPVMPALKHNLKRNKTALGKSLKTSIVYNNRDQISALKPPFDLVI--------AADVVYIEESVGQLVTAMEADDGAVLLGYQIRSPEADKLFWELCDIVFK.................... 198
65 -12.300[S] COG4121 Uncharacterized conserved protein  ali follow..  15  54.......................................................................................................................HNDDQRRFVIAETGFGTGLNFLAVWQAKLKELHFISFESDLIQAHQAWPELAQFAQKTLDLWFGDIKDCLPKVAQGLVDAWFLDGFAPSKNPE-MWNQNLFAGMAKLAKHGCTCATFTSAG-----------FVRRGLIDAGFAMKKVK---GFGTKRE 239
66 -12.200[S] KOG2912 Predicted DNA methylase  ali follow..  14  53......................................................................................................NRATYIRYIHDLLSSTSGQKDKKRIIGLDIGTGASCIYPLLGCR---DFVGTEIDKFSFETAKSNILQNNMES-QIKIVLRSKQDCLLPDGMEEFTFVMCNPPFYEHEEDFINFKQCTGVYHEMVTEGGEVGFANKILTESKKKKSSVPAVVDKLREQNISNYGIYE......... 239
67 -11.400[L] COG0863 DNA modification methylase  ali follow..  21  4....................................................................................................................................................................RTGCEPTRFGNEAKTIIHGDALAELKKLPTESVDLIFADPPYNIGKNFD-WLLEVIAECHRVLKKQGSMYIMNSTENMPF.................................. 95
68 -11.000[J] KOG1253 tRNA methyltransferase  ali follow..  18  216..........................................................................................................................ELKPPRVLEALSASGLRALRYAREGIGQVVALDNDPASVEACQRNIKFNGLMSTSKVESHLTDARVHMLSHPKDFDVVDLDP----------YGAPFLDSAVQSVADGGLLMCTATDMAV-----------------CGANGEVCYSKYGSYPLK. 348
69 -10.900[E] KOG1709 Guanidinoacetate methyltransferase and related proteins  ali follow..  12  53......................TALLESGAPWNALSPSNLSAGDFAMEAGHQETFDLLLKTGIQSELILGTIARNQTKNEYSNQEYLQDRVSFSEDKLMDSESKGVMMAWEKPLMEAHAKAICLNGGHILNVGFGMGLVDTAIQRYNPVKHTIIEAHPEVYKRMIE---SGWGEKENVKIVFGRWQDVLDKLDDNSFDGIFFDTYGEYYED----LREFHQHLPRLLKPDGVYSYFNGFCGSNAFFHVVYCNLVTEIENLGFST.............. 288
70 -10.800[V] COG3510 Cephalosporin hydroxylase  ali follow..  15  58.......................................................................................................GINCWKSVSDMWNYQEILSELQPSLVIEFGTRYGGSAVYFANI--FKVLTVDNSHKALD-------PRARREPDVLFVESSSTD-IQRLEYPGKIFAILDSDHSMNHVLA------MKLLRPLLSAGDYLVVEDSNINGHPVLPGFGPGPYEAIEAY-YKHDAERENKGFLIRN. 245
71 -10.700[J] KOG2539 Mitochondrial/chloroplast ribosome small subunit component  ali follow..  187...........................................................................................................YAEITRTLEEFNTIPDFQPETVLDFGSGAGAGFWAIQNKDVKEITMVDLSDAMMKFSMDSLRNEQ-NGRPFVHNNVNFRRHLIPSLNTTYDVVLA-----HRVLCEIGSSETRLQLIESLRTNRFLI--LIESSQT-GAFGGLLEARDFLLTQGTLVDY............ 346
72 -10.600[S] KOG4174 Uncharacterized conserved protein  ali follow..  11  55...........................................................................................................................EKNNRFLLLGEGNFSFAFSLLLHSEGFVLATSYDSK--DLKQKYPDAAEIEINGGKVMHEDATKL-KKLKTQKFDTIFWNFPHSGKGIKQKMLLAFFKASKFLLSEKGVIVITLAETKPYTL-----WNLKGLAKDAGYTSLMTEK......... 213
73 -10.600[D] KOG2360 Proliferation-associated nucleolar protein (NOL1)  ali follow..  15  226...........................................................................................................................PSGATVLDMCAAPGMVHICNVMQNKGCIYSVEQDHVRYNTLCEITKDAGCDI--VKPILGDALNLTPERFPD-VEYILVDPSDEPKEDKRLLQIKILSHAMGAFPNVKRIA-YCTCSLWKEENEQVVQRCLQL...................... 374
74 -10.600[J] COG1189 Predicted rRNA methylase  ali follow..  12  2................................................................AGLVVDSKSGERYDKPGQKIDDGTELRLKGEKLRYVSRGGLKLEKALKE-------HLEINGKTCLDIGSSTGGFTDVMLQNGAKLVYALDVGTNQLAWKIRS-------DERVVVMEQFNFRNAADFEQGRPSFTSIDVS--------ISLDLILPPLYEILEKNGEVAALIGIIRDPKVHQMTIEKVLKTATQLGFSVKGLTFS........ 203
75 -10.400[QR] COG0500 SAM-dependent methyltransferases  ali follow..  15  58.............................................................................PLHAQVCDHCFLVQLKEYFSPADICTEYAYFSSFATSWVSHAKNYCDDNSFVVEIASNDGYLLQHFLPKNIP-ILGIEPAANVARTAIAK--------PTLVDFFGSRLALEMIGEGRKADLILAQVPDL---------NDFVRGMQLLLKPEGLLRWNSRI....................................... 217

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Godzik A. Surface map comparison: studying function diversity of homologous proteins. J Mol Biol. 2001 Jun 8;309(3):793-806.