current user: public

If you have questions about the server, please let us know.

Query: [R] COG2768 Uncharacterized Fe-S center protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst MKDVFYTSTRAEVTDPAKWYQPDLSAVRKLEKLIDESGVLDVVSKGDVVAVKTHFGDRGTTRTLRSVFIRTVVEKVIEAGGRPFVTETTGLGMLRPRCTAVGRINIAEENGYTHQTLKAPIIIADGLLGFDYVEVPVEGKHLNSVKVAKAIAECDAVICCTHFKLHMQAGVGGSIKNVGVGCVAKPSKFDIHMSDYPQIDEEKCTKCDECVKICPSNAIEDYQINREKCVKCLGCSEACDYGAVKTFWVFGRDVSERIVECTKGVFKVQKNFAYLNFLMDITPHCDCHPYSDLPVVPDLGIMASKDILAIDRASVDLYRQAENLSGALLKDKKFWDWTDVEGMLNYAEKLELGTQNYRLIEISLast
1 -133.000[R] COG2768 Uncharacterized Fe-S center protein  ali  100  1MKDVFYTSTRAEVTDPAKWYQPDLSAVRKLEKLIDESGVLDVVSKGDVVAVKTHFGDRGTTRTLRSVFIRTVVEKVIEAGGRPFVTETTGLGMLRPRCTAVGRINIAEENGYTHQTLKAPIIIADGLLGFDYVEVPVEGKHLNSVKVAKAIAECDAVICCTHFKLHMQAGVGGSIKNVGVGCVAKPSKFDIHMSDYPQIDEEKCTKCDECVKICPSNAIEDYQINREKCVKCLGCSEACDYGAVKTFWVFGRDVSERIVECTKGVFKVQKNFAYLNFLMDITPHCDCHPYSDLPVVPDLGIMASKDILAIDRASVDLYRQAENLSGALLKDKKFWDWTDVEGMLNYAEKLELGTQNYRLIEIS 363
2 -38.900[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  20  2.................................................................................................SLTMRIFTASRNGQRLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNNKELSMEFADITDRAASTMFFGELLRGFAVTLAHIFKEPATINYPFEEHALRRYPSGEERCIACKLCEAICPAQAITRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLCNG............................................................................................ 199
3 -30.000[S] COG2006 Uncharacterized conserved protein  ali follow..  15  37......NPPRKSVVYVLKTERREEAVSKLMQNF----------FEGSTVGLKANYSADPFPASTHPKTLSAIVDVLKEQKAEVFMAERSGMGNTSAVLKTMGILDLAREKGFTVIDLDS--------YDGWVLHQPEDSHWKKGYPFADIFLTVDSVIQTCCLKTHRFGHFTMSLKNSVGMVARRWKGHDYMSEHTSPHMRKMIAEINVSYS--PKIVIMDAIKGFSH-----------PERGTVIEPGL--------------------------------------------------MIASNDRVAIDAVGVAILRIHGTTPEVSKGSVFEQE------QIARAIEIGLSSGEFEIIPA. 312
4 -26.300[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  26  110....................................................................................................................................................................................................AVIDENNCIGCTKCIQACPVDAIVGHTVMSDLCTGCNLCVDPCPTHCISLQPVAET............................................................................................................... 170
5 -25.600[C] COG1146 Ferredoxin  ali follow..  22  39....................................................................................................................................................................................................PTIDYDKCVTCGICFVTCGRRVFDIVARPYNCMVACQTCMNLCPTGAISFPDASYIKKLVAQNKIVK.................................................................................................... 113
6 -24.900[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  36  46....................................................................................................................................................................................................PVIDESKCVKCYICWKFCPEPAIYFVAIDYDYCKGCGICANECPTKAITMVREEK................................................................................................................ 105
7 -22.800[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  32  58.......................................................................................................................................................................................................GEERCVACNLCAVACPVGCISFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEFKR.......................................................................................................... 129
8 -21.300[C] COG1145 Ferredoxin  ali follow..  19  282....................................................................................................................................................................................................ATVDTSRCIACGICMLRCPMKAIKPASVDAEKCLGCGVCVPTCPMEAIELVERDELLELPDGMTYVQELLADKGRDPSGLF...................................................................................... 368
9 -18.200[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  19  50..........................................................................................................................................................................................................LCHHCEDCAVVCPVNAITRVQLNESLCVSCKLCGIACPFGAIEFSGSRPLDITPKAPPAPPAPARISTLLDWVPGIRAIAVKCDCSFDEQGPACVRM-------------PTKALHLVDNTDIARVSKRKRELTFNTDFGDLTLFQQAQSGEAK....... 203
10 -17.700[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  11  51.....HLRFGENRIRSAYLIQQADFVSCSTSAYLRSYDLLKGLKPGGTFLLNTIWEGEQLERHLPAAMREYIAK----NNIQFYTLNAMRIAGEAGLGRRINTVMQTAFFRVTDILPFEKALADMAVAEKNILAMDQTVANLHKVEVPESWANPVLTAEASTATEKPAY-ISNGMVSGAYPPGTAAYEKRGIALEVPEWISENCTMCNECAFVCPHAAIRRIQVSPMDCTGCNLCAETCPAKDKALVMKPFEEVAAKENP....................................................................................................... 363
11 -17.400[C] COG0348 Polyferredoxin  ali follow..  20  222.......................................................................................................................................................................................................HRQQCDNCMDCYNVCPEPQVESPLVLSKDCISCGRCIDVCPEKVFIFTTRFNHSVNHS.......................................................................................................... 289
12 -17.100[C] COG2440 Ferredoxin-like protein  ali follow..  15  25.................................................................................................................................................................................................RPHIKVRPHERPSANLLTHICPAKCYEQVETTSDGCMECGTCRVLCEASGE....................................................................................................................... 82
13 -15.000[C] COG1141 Ferredoxin  ali follow..  11  49......................................................................................................................................................................................................VDEITCIGCKHCAHVARNGRSRVIRQDGDAEEVIQEAIDTCPVDCIHWVDYTELKNLEEDRK....................................................................................................... 118
14 -15.000[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  34  64........................................................................................................................................................................................................SISCNHCDDCTKVCPSGAMHKVVVDEDVCIGCRYCHMACPYGAPQYNAEK................................................................................................................. 120
15 -14.800[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  33  39.........................................................................................................................................................................................................QACYQCGTCTGSCPSGRLVDEVIKSDECTTCYTCYERCPRGV........................................................................................................................ 99
16 -14.400[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  26  168.........................................................................................................................................................................................................YECILCACCSTSCPSERLDNLEDPFRRCHTIMNCAQACPKG......................................................................................................................... 240
17 -14.300[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  11  1MAAVVALSLRRRL---------PATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKI----------------YPLPHMYVIKDLV-PDLSNFYAQYKS-----IEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSERLAKLQDPFSRCHTIMNCTRTCPKG......................................................................................................................... 256
18 -14.000[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  14  9......................................................................................................................................................................................................IDYDVCAACGACEAVCPIGAVTEKGGGYQVCEGCLTCSRVCPVVDGFIQDELTNVRKFFGARSKDNVGSQDG-----------------------------GVASGILKSLFKQGKIDCAVGITRNEKWEPE----------VVLLTSAEDVRTRGTKYTSDPV. 150
19 -13.800[C] COG1140 Nitrate reductase beta subunit  ali follow..  20  212......................................................................................................................................................................................................IDQDKCRGWRMCITGCPYKKFNWKSGKSEKCIFCYVCSETCVGRIRYLIERAASTENEKDLYQRQLEVFLDPNDPKVEWKLALPLHPEYRTLPMVWYVPPLGILPDVESLRIPVQYLANLLTAGDTKPVLRALKRRAETVDGKVDTRALEEVGLTEAQYRYLAIA 450
20 -12.800[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  13  10.....................................................................................................................................................................................................SFFADLPKDNKKCIKIGSPLAL-----SLSDCLACSGCVSADEAGALSEDLSFVLDLSPQTSFVLSPQSKINIFNLYREDGMEYR---EFEAVLSSFLRSKFNIHRIVDTKIYEETYREYMATNHLIVSACPGVVTYIERTAPYLILSRVKSAFSLVKGSRTVSVM 178
21 -12.600[Y] KOG2439 Nuclear architecture related protein  ali follow..  15.........................................................................................................................................................................................................SPALACVKPTQVSGGKKDNKVSITLSDCLACSGCITSSEEILLSSQSVFLKNWGKLSQQQDKFLVVSVSPQCRLSLAQYYGLTLEAADLCLMNFQKHFQCKYMVGT----EMGRIISISKTVEKIIAHKKQKENTGADRKPLLSAV--LIYTEKTKQLVPLL 196
22 -12.300[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  11  83..HVYFAATAEDAIKNVAKQKNAKKIVKSKSMVTEEIGMNHVLEAEGIKVVETDLGEYILQVAEDKPSHIVVPAIHKDRHQIRKVLAEKLGYTGSDTIRNDFLEADIGVSGCNFAVAETGSVCLVTNEGNLRLATSLPKTHIAVMGMERLAPTFKEVDVL--ITLLARSAVGARLTGYNTWLTGPRLAGETDGPEEFHLEVLRCIRCGACLNTCPAGGYEEFKDLPSACSLCTACNQVCPVK......................................................................................................................... 375
23 -11.600[C] COG1600 Uncharacterized Fe-S protein  ali follow..  34  195........................................................................................................................................................................................................EEGCGKCVACMTICPTGAIVEPTVDARRCIGCDDCQLICPWNR........................................................................................................................ 262
24 -11.000[O] COG1180 Pyruvate-formate lyase-activating enzyme  ali follow..  10  15............................................................................................................................................................................................................IRCLACARKCPLVHFNVFSFSTYGCWMCMYCQNYDISQRRKAEG-------VELSPEEIVELAMGYDVDGMTYTYNEPAIFSEFAHDVGIVAKRYGLYWTPNLVDYVKDFLDAVT--IDFKGNGEQKFLRRYTGATEPIIETASELQIGDDLQAAKQLL 233
25 -10.800[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  11  179LSACHTGQEGDSKDFESKAFHAGDDLTREVADLAQIVALDLPKGDEDAPLVELGFGTIDTEKPVNVLPGADIVDYLDENEMEDQVEVCGICCAAIDVTRYNEAAKVVGPLSKQLRFIRSGVADVIVVDEQCVRTDVLEEALKNRSAVIATTEDPDKIVNDLINGNIEGALILDAVKTAMKLAPIRKSLKKLPDIDEIIELASECTDCGWCQRVCPNSLPVMDAVKKELCYTCGRCEQECERNGERRVKDEKYRIRAGRGPAQDVEIRRVGAPIVLGDIPGVVVGCSNYPEGGKDVALMAKEFLERNYIVVTTGCGAMSIGEYRDEDGQTLYEKYGGQFDAKGLVNMGSCVSNAHVSGAAIKIA 595
26 -10.400[C] COG1036 Archaeal flavoproteins  ali follow..  17  5...................................................SIAWGITGAGHFLDRSY--QVFKELKQRDPELSVNTYIS-------RAAEEVLRMYGLEQKLVKISGGDYLEEIFRESEQGSSSPKVGRFLLDRYDALFVTPATSNTVSKIAYGIADSLVTNAVAQVPVYVVPVDIEGSIISEMPYNIDRKQCRHCETPRENCPHGAITEDQIELLKCKGCGICKELCPYNAIKGG.................................................................................................................... 203
27 -10.300[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  16  417...........................EGVDITICMGASVGVSNGLAHVLNNKIIATIGDSTFIHAGIPPLINAVYNHADFVLVILDNSTTGMTGHQPHPGTGFRGCGEAGKAVRI--EDIVRGCGVEFVEVVNPYNVRKMVDVLRRALNHDGVAVVIARQP-------------------AILWSRARRREGKIVTYKVTEDCTLCMECVNTCPALI-EKVSIDQSLCVGCAVCAKICPNRAIKPAKSN................................................................................................................. 623
28 -10.200[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  15  1.............................................................................................................................................MKQVAVISGTGKTTFSATIHALEGGVVADCDVDAPNLHILLPQILKAEDFIASKKARIMPEKCSSCGLCYDLCRFGAVDGYYVDEKKCEGCAFCFNVCPERAIEMENVKTGDLYVLVTEVKNRAKEIAEESNAEFLIVDSAPGVGCPVMASLTGVDAAIIVTEPTVSGLDMLRILELCEHFRIRPFVVVNKFDLNVNIASEIESYCSENGAGRVPFD--AIP 254
29 -10.000[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  25  595....................................................................................................................................................................................................AVTDSDVCGGCEVCIELCPFGAISHANVNVALCKGCGTCVAACPSGAMDQQHFRTEQIMAQIEAALNE................................................................................................... 666
30 -9.430[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali follow..  12  1MTADPVAQRLQKRLPVPYTEWLPELIRRNVGKWVDIEPISSTGDRVFTVKVGTPPN-----FRMSTETLRKFIDIADKLGGGIKITRNGNLEILTDSLDKALKIEEVEKMGFPVGGWGRSMWGINSCTAFLTCTTAVVDSPSITKALGDALAPYFKEESLPAKLRIFVSG-DIAIVGQWGAPPKIREEVIGMCLPPPRALAKVTESQIFLVQVCPTGAHTKLVLLGEKCINCARCKENCDAFDYDPENVGVA--------------------ILVGGKMSNTGGGARLARVLIPWLPAK-PPRYEEIIAVVKHVIEVWRQ---------------HAKPGERLADFIDRVGWSKFLELVGL.. 348

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.