current user: public

If you have questions about the server, please let us know.

Query: [S] COG2833 Uncharacterized protein conserved in bacteria, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MTDKPTYEQTLRGNAIRAISACDLDEKVRLARETASRWFARALSVRSPLDPPLPERPGRPEKPELVPPRMLKKRSLNTEHGRIALMHALAHIELNAIDLALDIVARFAVKPIPRSFFDGWMKVADDEARHFTLLRNRLKSLGADYGDMPAHDGLWQSAHQTRNDLEARLAVVPLILEARGLDVTPSLLEKMIETGDHETAAILNIIYNDEKTHVAVGAKWFRFFCARNRIDPAARFRELVRANFRGELKPPFNELARAEAGLTPSFYRSLSPVSILast
1 -109.000[S] COG2833 Uncharacterized protein conserved in bacteria  ali  100  1MTDKPTYEQTLRGNAIRAISACDLDEKVRLARETASRWFARALSVRSPLDPPLPERPGRPEKPELVPPRMLKKRSLNTEHGRIALMHALAHIELNAIDLALDIVARFAVKPIPRSFFDGWMKVADDEARHFTLLRNRLKSLGADYGDMPAHDGLWQSAHQTRNDLEARLAVVPLILEARGLDVTPSLLEKMIETGDHETAAILNIIYNDEKTHVAVGAKWFRFFCARNRIDPAARFRELVRANFRGELKPPFNELARAEAGLTPSFYRSLSPVSI 275
2 -28.100[S] COG3396 Uncharacterized conserved protein  ali follow..  12  24..........................................................................PDAYRKTLIRQIGQHAHSEIVGMLPEGNWITRAPT-----RRKAILLAKVQDEAGHGLYLYSAAETLGCAREDILDGRMKYSSIFNYPTLSWADIGVIGWLVDGAAI----VNQVALCRTSYGPYARAMVKICKEESFHQRQGFEACMALAQGSEAQKQMLQDAISARSLTWKIKRFTNDELRQR--FVDNTVPQVEMLGM 238
3 -22.200[R] COG2406 Protein distantly related to bacterial ferritins  ali follow..  16  15.............................................................................DVDKLLELLIKNAAAELTTYYYYTILRANLIGLEGE-TIKEIAEVARIEDRNHFEALVPRIYELGGKLPDCMHDLSACPPARLPDKPTVQEILRVLVAAERCAVKGYTEICNMTAG-KDHRTYELSLAILNEEIEHES----WFSEFLGEGPSG............................................ 165
4 -21.300[P] COG2193 Bacterioferritin (cytochrome b1)  ali follow..  11  1...........................................................................MKGDTKVIERLNEALFLELGAVNQYWLHYRLLNDWGFT-KLAKKERAESIEEMQHADKIIDRIIFLEGHPNLQTLAP-------LRIGQNVKEVLEADLAGEYDARTSYKKSRDICSEAGDYVSMKLFEALLIDEEGHIDFLETQLELL................................................... 141
5 -18.700[F] KOG1567 Ribonucleotide reductase, beta subunit  ali follow..  58...............................QAQASFWTAEEVDLSKDL-------------------PHWNKLKADEKYFISHILAFFAASDGIVNENLVERFSQEVQVP---EARCFYGFQILIENVHSEMYSLLIDTYIRDMPYVKKKADWALRWIADRKSTFGERVVAFAAVEGVFFSGSFAAIFWLKKRG-PGLTFSNELISRDEGLHCDFACLMFQYLVNKPSEERVREIIVDAVKIEQEFLTEALPVGL---IGMNCILMKQYIEFVA 290
6 -17.900[C] COG1592 Rubrerythrin  ali follow..  12  2................................................................................GTLENLVKAFIGESMARNRYTFYAKVAKDEGYV-FIQRVFLETAENEKEHAENLLKFIQQLRGDNAAIKVEAEAPLVWGTTVENLKAAIEG----EHYENSEMYPQFADEAEKEGFKDIADRLRAIGKAEEHHERRYRRLLAEV-ENGTFFKRDKEIAWVCLECGYIHYGTEPPEECPSCGHPKAYYVAEDLLSL 190
7 -17.500[S] COG1633 Uncharacterized conserved protein  ali follow..  11  12...........................................................................VRNLKGIEEAIALAIDREKEAREFYLQQAGLMENP----KFKELYEELAAEEMKHLGYLENYRDKKELPEISTEVPSG--RTKVGEITLGDAGILLAAMRHERKSEDFYSEMAK---RVEDETQKKFFEMLSRYERGHYEVIDSYLEYITQ................................................. 163
8 -16.900[S] COG4902 Uncharacterized protein conserved in archaea  ali follow..  10  45............................................................................PLSDEEANSLLYMIEEEKLARDVYLKLYNETGLI---------FDRIAQSEQRHMDAVLMLIEKYNLT--ENEELQNLYNELVEMGSQSVVDALKVGALIEEIDIKDLEEWLS---KVDNEDIKVVFENLMDGSKNHLRAFTKVLADNYGI................................................ 193
9 -16.600[F] COG0208 Ribonucleotide reductase, beta subunit  ali follow..  10  55...............................KQLSFFWRPEEVDVSSDR-------------------IDYGKLPDHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSLP---ELETWIETWSFSETIHSRSYTHIIRNIVNDPAVV-INGETITVSLKELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERE-EGNAKIIKLIARDEALHLTGTQHMLNLLRNGMDDFTFLQVAEECKQESFDLFKEAAEQEKESMIGLNKDILCQYVEYIT 325
10 -15.400[P] COG3546 Mn-containing catalase  ali follow..  12  16............................................................................EPNPGLANLLLEQFGGPQGELAAACRYFTQGLSDDDA-GRREMLMDIATEELSHLEIIGSLVGMLGGGPALTNSGGVPWTAAYIDTIGEVTADLRSNIAAEARAKIIYERLINL---TDDPGVKDTLSFLMTREVAHQLSFEKALYSIRNNFPPGKLPPVEQYTDVYY............................... 215
11 -14.500[FJ] COG4445 Hydroxylase for synthesis of 2-methylthio-cis-ribozeatin in tRNA  ali follow..  15  44.............................................................................DPQNLPLLLTDHLICELKAAQTALLLVRKYVADKSGRQLIDRMVLLIKEELHHFWQVREVMQARNIPYVKITASKGMLKAVRTHEPLTLIDKLICGAYIEARSCERFAALAPWL----DEDLQTFYLSLLRSEARHYQD---YLALAQQISAEDISARVRYFGE--VEADLILSPDREFRFHSGVPAA.......... 269
12 -14.000[H] COG5424 Pyrroloquinoline quinone (Coenzyme PQQ) biosynthesis protein C  ali follow..  10  1MSEFFDRTGPLQEWAQQLIVDCQASKDRVSGHELYRRMRDAELS----------------------------------PALMRLYLIGGWPVVEQFPLYMSQNLLKTRFARHPGEDRRWLMRNIRVELNHADYWLHWAEAHGVSLAEIQAQDVPWCWHTCASDSLAVAMAATNYAIEGVTGEWSALVCSNGVYEGRKRAMKWLKLHAQYDDAHPWEALEIICTLAGTNPSAEL---------------RRQLRDAICKSYDYMYLFLERCMQLE. 247
13 -13.100[P] COG1528 Ferritin-like protein  ali follow..  12  3..............................................................................SQAIAEKLNEQINLEFYSSNVYLQMSAWCAHHGYE-GAAAFLLRHADEEMEHMQKLFNYVSETSGMPLLGKIEA-------KNDYKTLKEIFEITLEHEKFVTSKINELVEVTFAHKDYSTFNFLQWYVAEQHEEEMLFNSIIDKF................................................... 141
14 -12.900[H] COG2941 Ubiquinone biosynthesis protein COQ7  ali follow..  12  36..........................................................................SEKDSNILDSVIRVDQAGELGANQIYKGQHFILQFTDP--KVAPTIQHMWDQEKYHLATFDNYVLKNRVRPTFLRPFWDIAGFALGAGTALLGTKAAMACTVETVIGGHYNDQLRETKAPEFKEIRSHLAEFRDDELEHLNTAV--------EGWNAKEAPAHALLTNAIQMGCKAAIWMCKR.................. 215
15 -12.900[R] KOG4061 DMQ mono-oxygenase/Ubiquinone biosynthesis protein COQ7/CLK-1/CAT5  ali follow..  12  36..........................................................................SEKDSNILDSVIRVDQAGELGANQIYKGQHFILQFTDP--KVAPTIQHMWDQEKYHLATFDNYVLKNRVRPTFLRPFWDIAGFALGAGTALLGTKAAMACTVETVIGGHYNDQLRETKAPEFKEIRSHLAEFRDDELEHLNTAV--------EGWNAKEAPAHALLTNAIQMGCKAAIWMCKR.................. 215
16 -12.800[S] COG3461 Uncharacterized conserved protein  ali follow..  18  13................................................................................................................................................................TGKDRDFVRALNSLKEEIEAVAWYHQRVVT---TKDETVRKILEHNRDEEMEHAAMLLEWLRRNMPGWDEALRTYLFT..................................... 87
17 -11.000[S] COG3685 Uncharacterized protein conserved in bacteria  ali follow..  12  12.....................................................................................LRDAHAMEEQAITMLTSQSSRLENYP---ELKTRIDRHLQETKDQAAMLERCLERLDGGTSSGKIVAFGQGLSGLFVSDEVVKGTLASYTFEHMEIASYRILIAAAEQAGDQETKRVCESILQQEIAMAE----WLAQNAGE................................................ 151
18 -9.630[R] COG3687 Predicted metal-dependent hydrolase  ali follow..  71............DMSGIYVNAVATFSEGAAMVSVDDRATGPHSSESRAADHERLVLEPRDVEFDW---TNLPFHYVPNEPMATHVLNVLHMLLPAGEEFFVRVFKKTLPLIKDDQLRLDVQGFIGQEAMHSQAVVDHFDAQGVDVTAFTNQIRWLFEKLLGESP-LLEQVSFIAAIEHYTAVMGEWILNSDAVGADPVMLDMLRWHGAEEVEHKAVAFDTMKHL................................................... 294

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.