current user: public

If you have questions about the server, please let us know.

Query: [C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst MNAIWIAVAAVXLLGLAFGAILGYASRRFAVEDDPVVEKIDEILPQSQCGQCGYPGCRPYAEAISCNGEKINRCAPGGEAVMLKIAELLNVEPQPLDGEAQELTPARMVAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDSWKWDLNTIPVRIIPVEHHALast
1 -73.000[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali  100  1MNAIWIAVAAVXLLGLAFGAILGYASRRFAVEDDPVVEKIDEILPQSQCGQCGYPGCRPYAEAISCNGEKINRCAPGGEAVMLKIAELLNVEPQPLDGEAQELTPARMVAVIDENNCIGCTKCIQACPVDAIVGATRAMHTVMSDLCTGCNLCVDPCPTHCISLQPVAETPDSWKWDLNTIPVRIIPVEHHA 192
2 -30.800[C] COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit  ali follow..  31  42.........................................................................................................RTFMPVIDESKCVKCYICWKFCPEPAIYIKEDGFVAIDYDYCKGCGICANECPTKAITMVREEK....................... 105
3 -30.400[C] KOG3256 NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit  ali follow..  26  112..............................................................................................................PSGEERCIACKLCEAICPAQAITIEAEERADIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETH................. 185
4 -29.900[C] COG1146 Ferredoxin  ali follow..  21  39.............................................................................................................PTIDYDKCVTCGICFVTCGRRVFDFDKKEIVARPYNCMVACQTCMNLCPTGAISFPDASYI...................... 102
5 -29.800[C] COG1145 Ferredoxin  ali follow..  28  273....................................................................................................NTIAHSSYLATVDTSRCIACGICMLRCPMKAIKAKINEPASVDAEKCLGCGVCVPTCPMEAIELVERDELLEL................... 346
6 -28.900[C] COG1143 Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I)  ali follow..  32  59.................................................................................................................EERCVACNLCAVACPVGCISLQKAETERINFSRCIFCGLCEEACPTTAIQLTPDFEMGEFKR................. 129
7 -26.300[R] COG2768 Uncharacterized Fe-S center protein  ali follow..  26  197.............................................................................................................PQIDEEKCTKCDECVKICPSNAIED-----YQINREKCVKCLGCSEACDYGAVKTFWVFGR...................... 252
8 -24.700[C] COG0437 Fe-S-cluster-containing hydrogenase components 1  ali follow..  17  14.............................................CTGCKTCELA------------------CKDFKDLGPEVSFRRIYEYAGGDWQEDNGVWHQNVFAYYLSISCNHCDDCTKVCPSGAMHKREDGFVVVDEDVCIGCRYCHMACPYGAPQYNAEKGHMT--KCDGCPICVESCPLRALE 151
9 -24.500[C] COG1014 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, gamma subunit  ali follow..  32  267.........................................................................................................ALEVPEWISENCTMCNECAFVCPHAAIRPILRYRIQVSPMDCTGCNLCAETCPAKALVMKPFEEVAAKEN................. 362
10 -24.100[C] COG1141 Ferredoxin  ali follow..  23  43.........................................................................................................RQKGVYVDEITCIGCKHCAHVARNTFYIEPDYGRSRVDGDAEEVIQEAIDTCPVDCIHWVDYTE....................... 109
11 -23.500[R] COG2000 Predicted Fe-S protein  ali follow..  14  1.............................MSQDKSLKEEVTALLPGYNCGICGYARCDEYAAALLKGRAEIDRCHFMYQELFADNLKRLQDILKEEKLLEEEKKIFGVLTELRKGDII--RYRPLGCPITHFAEILDENHGLITVHIVGPCHRLGMDDFEYRDIGVCMVGGFEGVKVHSGVVVQLEGRRAV. 209
12 -22.900[C] COG1142 Fe-S-cluster-containing hydrogenase components 2  ali follow..  16  5......................................VIADSTLCIGCHTCEAACSETHRQHGLQSMPRLRVMLNEKESAPQLCHHCEDAPCAVVCPVNAITRVDG-AVQLNESLCVSCKLCGIACPFGAIEFSGSRPLDIPAVKCDLCSACVRMCPTKALHLVDNTD....................... 171
13 -21.600[C] COG1035 Coenzyme F420-reducing hydrogenase, beta subunit  ali follow..  30  2........................................................................................................PPKIAEVIDYDVCAACGACEAVCPIGAVTVKKAAEKGGGYQVCEGCLTCSRVCPV................................. 67
14 -21.500[C] COG0348 Polyferredoxin  ali follow..  19  197...................................................CGHLCPIGAAYGVIGAKGLFR------------------------------------IKVEHRQQCDNCMDCYNVCPEPQLHAKKSESPLVLSKDCISCGRCIDVCPEKVFIFTTRFNH...................... 284
15 -21.300[C] COG1140 Nitrate reductase beta subunit  ali follow..  12  130.............................................ITGERMAKIEKGPNWEDDLGGEFDKLAK------------------KNFDNIQKAMYSQFENTFMMYLPRLCEHC-ACVATCPSGAIYKEEDGIVLIDQDKCRGWRMCITGCPYKKIYFNWKSGKSE--KCIFCTVCSETCVGRIR. 268
16 -20.500[C] COG1036 Archaeal flavoproteins  ali follow..  24  147..............................................................................................................NIDRKQCRHCETPRENCPHGAITEKNGVTDQIELLKCKGCGICKELCPYNAIKGGPVEVLVRDVDMRNVEITVLESPEAILE 237
17 -20.100[C] COG2440 Ferredoxin-like protein  ali follow..  15  29..............................................................................................................KVRPHERPSANLLTHICPAKCYELNDKGQVETTSDGCMECGTCRVLCEASG............................... 81
18 -19.800[C] KOG3049 Succinate dehydrogenase, Fe-S protein subunit  ali follow..  21  184..................................................................................................................YECILCACCSTSCPSSRDDFTEERLAKLQDPRCHTIMNCTRTCPKGL............................... 257
19 -19.500[C] COG0479 Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit  ali follow..  21  168..................................................................................................................YECILCACCSTSCPSYWWEATGERLDNLEDPRCHTIMNCAQACPKGL............................... 241
20 -19.100[C] COG1150 Heterodisulfide reductase, subunit C  ali follow..  23  39..................................................................................................................QACYQCGTCTGSCPSGRLGLVDEVIKSDELWMCTTCYTCYERCPRGV............................... 99
21 -19.100[R] COG3383 Uncharacterized anaerobic dehydrogenase  ali follow..  16  1MGAKVSVRINGEARDVVEGTRILDYLNAEGIQ--PHICYSEQIGPIQSCDTCMMRACSTNLTDGMEIKTNSELAKDAQLEAMDRILENHLLYCTVCDNNNGNCKVHNTTELLDPDQCILCGRCVEACQNETLSIDWERSQPANLSSCVSCGLCATVCPCNALM............................. 207
22 -19.100[C] COG1600 Uncharacterized Fe-S protein  ali follow..  36  195.................................................................................................................EEGCGKCVACMTICPTGAIVEP----YTVDARRCIGCDDCQLICPWN................................ 261
23 -18.800[C] COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain  ali follow..  25  311...................................................................................................................RCIRCGACLNTCPASVISPILGGYEEFKDSACSLCTACNQVCPVK-IPLANLLLKH..................... 385
24 -18.800[C] COG1148 Heterodisulfide reductase, subunit A and related polyferredoxins  ali follow..  22  546............................................................VDTLTDGVYLAGVAQGPKDIPDAVAQASGAAARAAIPMVKGEVEIEPIVAVTDSDVCGGCEVCIELCPFGAISIEEG-HANVNVALCKGCGTCVAACPSGAMDQQHFRTE...................... 654
25 -18.300[Y] KOG2439 Nuclear architecture related protein  ali follow..  14  15..................................................................................................................SPALACVKPTQVSGGKKDNVDQLEKVSITLSDCLACSGCITSSEEILLSSQSHSVFLKNWGKLSQQLVVSVSPQCRLS 108
26 -17.700[C] COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits  ali follow..  14  455...........AGIPPLINAVYNHADFVLVILDNSTTGMTGEAGKAVRIEDIVRGCGVEFVEVVNPYNVRKMVDVLRRALNHDGVAVVIARQPCAILWSRARRREGKIVTYKVTEDCTLCMECVNACP--ALIFDGEKV-SIDQSLCVGCAVCAKICPNRAIKPAKSN........................ 623
27 -17.300[R] COG4624 Iron only hydrogenase large subunit, C-terminal domain  ali follow..  20  10..............................................................................................................SFFADLPKDNKKCIKIGSPLALSL----------SDCLACSGCVSADEAGALSED........................... 54
28 -16.800[C] COG1152 CO dehydrogenase/acetyl-CoA synthase alpha subunit  ali follow..  23  407..................................................................................................................SECTDCGWCQRVCPNSLPVMDSKLEEMAIEELCYTCGRCEQECERNI............................... 463
29 -15.800[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  29  59............................................................................................................KARIMPEKCSSCGLCYDLCRFGAVVAEDG--YYVDEKKCEGCAFCFNVCPERAIEMENVK........................ 116
30 -15.400[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali follow..  104......KALKIKEEVEKMGFPVGGWG-----------RSMWGINSCTAFLTCAVVDSPSITKALGDARIFVSGCPAMCAGGTAIDIAIVGQWGAPPKIREEVIGMCLPPPRALAKVTESQIFLVQVCPTGAHTLRDKVKLVLLGEKCINCARCKENCDAFDYDPENVGVAILV................... 278
31 -15.200[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  12  3MATIHVD----KEYEVNGADNLLEACLSLGLD--PYFCWHPALGSVGACRQCAVMSCMTPASLMTNHPHDCPVCEEGGNCHLQDMTVMTGHSFRRYRFTKRTHRNQDLGPFIEMNRCIACYRCVRYYKGTDLGVYGAHDNVYFGRESEFSGNLVEICPTGVFTDKTHSERYNQFAPSICQQCSIGCNIS... 240
32 -15.000[C] COG4656 Predicted NADH:ubiquinone oxidoreductase, subunit RnfC  ali follow..  15  272...LMQNVGTVVAIKRAVIDDEPLIERVVTLTGDALSSPGNFWAR---IGT------LYLLKLAGFKPQNPPMVIMGGPLMGFTLPSL-DVPIVKISNCILAPAETEMGLSEPEQSCIRCGLCVDACPAGLLGEEHEKARNHNLFDCIECGACAYVCPSNI............................... 430
33 -14.300[R] COG1453 Predicted oxidoreductases of the aldo/keto reductase family  ali follow..  17  189.....LKYAASKGLGVMIMEPLRGGNLARTVPLAIENIWSEADVERTPVEWALRVWNHPEVTVVLSGMNEEVHI-----KENLKIASEAYPNSLTEAELQLVSKVEQKYRQIMKVGCTGCQYCMP-CPSGVLSGAVSGGKPGMASQCVQCGQCLEKCPQH-IDIPTILESVAE................... 378
34 -14.200[C] KOG2282 NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit  ali follow..  14  31LIEVFVD----QSVMVEPGTTVLQACEKVGMQ--PRFCYHERLSVAGNCRMCLVAACAMPVMLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVIMTRCIQCTRCIRFASVDDLGTTGRGNDMQVGTMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAV.... 257
35 -13.400[S] COG3592 Uncharacterized conserved protein  ali follow..  22..............................................................................................................YFNTNICAHSGNCVKGNA-ELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEK......................... 77
36 -12.700[S] COG4871 Uncharacterized protein conserved in archaea  ali follow..  25  119.............................REKVRVEPMEIYKYLPQTNCGKCGEQSCYTFAIKLMSGETNLEKCMPLKEPGYATNLEHL....................................................................................................... 178
37 -12.700[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  15  273................................................CDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYR------------------QCIECKCC-NICGTSE-----------NDDQLLFCDDC-MYCLTPSMSEPPEGS----HLCLDLLKEKASIYQNQNS 390
38 -12.000[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  28  3............................................................................................................IAILNKDKC--CSKCEKYCPRETIVFEDDGKPVISEELCVGCGICINKCPFDAIMIIGLPEALQ.................... 74
39 -10.800[C] COG1726 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA  ali follow..  18  371.................................................................................................................ERAMVPIGAYERVMPLDLAAGDTDSAQALGCLELDDLALCTFVCPGKN............................... 429
40 -10.700[C] COG0247 Fe-S oxidoreductase  ali follow..  11  264................................EDFRQSQLLDLYACVECGRCTNMCPATGTGKMLSPMDLILRLRDHLTEKGAAVT-----------------------------SRSPWVPAAAFRHTRGNQLAAASAGVITEEACTTCRNCEDQCPVMN............................... 385
41 -10.700[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  16  39.....................LRGQGRYFGVSDDDKDAIKEAAPKCNNCSQCPHIICSDHYSRHCPKAIQCSKCDEVGHYRSQCPHKWK------------------------KVQCTLCKS-KERCPVDDNEKAKPKVLPFHTIYCYNCGG-GDDCKE................................. 179
42 -10.100[C] KOG2415 Electron transfer flavoprotein ubiquinone oxidoreductase  ali follow..  14  555........................................................................................................................GPEQRFCPAGVYEFVPVEQGQINAQNCVHCKTCDIKDPSQNINWVVPE........................ 607
43 -10.100[S] KOG4791 Uncharacterized conserved protein  ali follow..  12  6..................................................................................................................EDCY--STCTKSCPF-----RHCEAALGNETVCT--GRCFRRCRFRHMEIDKKRSEIPCYWENQPTGCQKNCV..... 81
44 -9.950[C] COG1894 NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit  ali follow..  12  313HLDLPMDFENIAKA----GSRLGTALAMAVDHEIGMVSLVRNLEEFFSRESCGW----------------CTPCRDGLPWSVKILRALER---------EGQPGDIETLEQLCRFLGPGKTFCAKAYESGMTSGNTRAIAGIQPNLLKAR.......................................... 460
45 -9.810[S] KOG4376 Uncharacterized conserved protein  ali follow..  13  10...........................................................................................................................MVYCPYNKEHKMLRKKLQQHILKCRV----LMVCPFNSSHLIPEPQFFQH---------TQSCEDRN.. 70
46 -9.760[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  12  1...........................................MYGTRCHGCGEFVEGEVVTALGKTHPNCFACTICKRPFPPG---VTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRCFK-CKSCGKVLTGEYISKDGAPYCVKCEACHQFITGKVLEAGDKHYHPSCARCSRCN............ 163
47 -9.580[O] KOG1100 Predicted E3 ubiquitin ligase  ali follow..  17  264.............................................................................................EERWKLAGEAQDTKKMCRVGMSMCRSCGKCRHMC------------------LCSVCGSSLNTCPIASLHV............................ 331
48 -9.570[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  23  842..................................................................................................................KNILKCGVCFDRPKEVVIV------------KCLFCQQCIQKCPG................................. 884
49 -9.490[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  14  2.................................................................................................NASTSSPSQQLQQAINSTIDKECAVCYSEMP-------------TTIPSC--CFICLKDCPI................................. 62
50 -9.320[TZR] KOG1704 FOG: LIM domain  ali follow..  13  180.......................FDFQVIFGDECLEAEGRSWHFHHFQCAQCNDV--ADQKYMQRANKPVCLKC----------------------------------HSSSSTFSCTTCRLSFSS-DTPHMSQGDLHWHA--SAECFCCCVCSKNCGYQT............................... 294
51 -9.290[J] KOG2613 NMD protein affecting ribosome stability and mRNA decay  ali follow..  13  12.............................................................................................................QNAATLLCCNCGTCYD-CIKLTVDITQGIPREANISFCRNCER........................................ 63
52 -9.210[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  13  79................................................CFACRQQG--HIVQDCPEAKDNVSICFRCGS-------------------KEHSLNACSKKGPLKFAKCFICGHLSGQCEQNPKGLYPKG------GCCKFCSS-AKDCDQ................................. 168
53 -9.180[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  15  275.....................................................................................................................FACFICREPFVDPVVT------------KC--CEHCAKKCFV................................. 313
54 -9.030[C] COG2080 Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs  ali follow..  15  96.................................................................................................................KKGC-QCGACLNACLTLAVMHQGAEITTIEKHDGFQCGYCTSGQICSSVAVLKEIQD...................... 178

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24