current user: public

If you have questions about the server, please let us know.

Query: [S] COG3091 Uncharacterized protein conserved in bacteria, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MSTLRIPIALQQAVMQCLRHYLQLANQHLGTAYPEPKVNYHQRGTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYRQFGRVAPHGKEWRWMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHSLTIRRHNKVLRGESEYRCRQCGEKLQFITINPDLast
1 -91.200[S] COG3091 Uncharacterized protein conserved in bacteria  ali  100  1MSTLRIPIALQQAVMQCLRHYLQLANQHLGTAYPEPKVNYHQRGTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYRQFGRVAPHGKEWRWMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHSLTIRRHNKVLRGESEYRCRQCGEKLQFITINPD 170
2 -35.200[S] KOG3931 Uncharacterized conserved protein  ali follow..  13  108MNLVDPEWELVDPTPDIYAMFIRFDEKFFQERLGAVSLEWSKKMYCAGICYQRGNTIRLSEPLLKLRPRKDLVETLLHEMIHAYCFVLNIGNGGHGPNFKRIMETINKVAGTNITVYHTFHDEVASYRIWRCTGICRERSPFWGYVKR-TSNRAPGPNDQWWKMHQRE.. 285
3 -17.100[R] COG1451 Predicted metal-dependent hydrolase  ali follow..  18  64......QDLKNQFLRNAPPINKVMYDNKIHVLKNALGLHTAVSRVQGGKLK-AKAEIRVATVFRNA-PEPFLRMIVVHELAHL-------KEKEHNKAFYQLCCHM................................................................ 154
4 -12.900[O] COG0501 Zn-dependent protease with chaperone function  ali follow..  20  57YRAREVTPAESPNLHRIVDGLALKAN------IPKPKVYVMPNAFATGR-NPQHAAVAVTTGILNLLSYEEIEGVLAHELAHVK...................................................................................... 137
5 -12.500[D] KOG4842 Protein involved in sister chromatid separation and/or segregation  ali follow..  16  161.PSAALKRMHMLAADPGIIAVMNKHRWRVGTELAPVGYVGVSPRCLLGFNKNQGEEISL--RLRTDDLKQSIKKTLLHELAHMV-------YTEHDEKFYALDSQL................................................................ 263
6 -10.900[P] COG2703 Hemerythrin  ali follow..  11  30VEVVSDRSVSKNEVKELLAEFFNYMKDHFNDE------KYMQLIGYPNLEEHRKIHKEIIQTMINLIKDIKSTNDLKEKLYIVAKKWLLEHILYEDMKVEKWRSSSLSTDDGGDVSFEAAEDEDNEYLYTCNCPGHDVPYSIHQKIELQGRKFTCKTCKQAIKFYKK... 197
7 -10.600[S] COG3864 Uncharacterized protein conserved in bacteria  ali follow..  10  4...........EETLKKALLNIGKESPFYYYVLLGVKLVPSKNTRNLKFSTTGDVMLLYNPEAIGKKPLRMVQALLIHEVMHIVL--------QH........................................................................... 81
8 -10.200[O] COG5504 Predicted Zn-dependent protease  ali follow..  12  50.NIKEGIQTVSKLKEKGFYGHIQKEEQYLKNKWQGPDVPILEFGSKSGLAFQDKMFLFLSSDL----DFGSVSALMTHEYHHVCRLGHLTKEEKDVTLLDTIIME................................................................. 162
9 -9.830[O] COG5549 Predicted Zn-dependent protease  ali follow..  10  82WSKFPVTVAVDYPPGLTPGSAAQKRYYTWQQAIKTAIADWQEFFPLTIVENTTEADITIF-AIKPGLAPLSLQGTARHELGHAL--------WGHSDHKEDALY----AQTADVPAISPRDLRTLYRLY......................................... 247
10 -9.770[L] KOG3314 Ku70-binding protein  ali follow..  11  21KSIDECQDMIRRSFRNPIVKFLMEQMEKSGCRVGDNFVKAVVTGPVAGGYTKGRGITVCSNYL---TIQDEVNQVVIHELIHAYDECRAKNLDWTNCA-HHACSEIRAGH-HFKRELLRGFIKLRGHEQECIKRRVLKSLRGNPYCSEVAAKDAMEACYNDTKPFDRAP. 194
11 -9.560[R] COG4900 Predicted metallopeptidase  ali follow..  22  65........................................................MELLRPFKRLSCAERVK-VIAHELAHI---TKSGALRPHNKAFWRDYKLY................................................................ 112
12 -9.430[E] COG0308 Aminopeptidase N  ali follow..  15  215......DKPKVGFAVESLKNAMKWDETRFGLEYDLDIFMV--AMENKGLNIFNTKFVLADSRTATDTDFEGIESVVGHEYFHLTVFRDQEFSGDRASRAVRRIENIRLLAGPTAHPVRPASYEEMNNFYTMTVYEKGAEVVRMYHTLLGEEGFQ................ 397
13 -9.360[R] KOG2719 Metalloprotease  ali follow..  15  212...APLFNKFTPLPDGDLREKIEKLASSLKFPLKKLFVVDGSTRSSHSNAYMNKRIVLYDTLIQQCKNEDEIVAVIAHELGHW....................................................................................... 296

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24