current user: public

If you have questions about the server, please let us know.

Query: [H] COG3172 Predicted ATPase/kinase involved in NAD metabolism, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst TEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQRLast
1 -84.500[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali  100  1TEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR 187
2 -63.100[R] COG3911 Predicted ATPase  ali follow..  18  1..MQNDFDRVFVLTGGPGSGKTTLIAALRRA-GFATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSAVEQKGPVFFDRGVPETLGYLRLSGLPVADHVSTAAKRFRYNPRVFIAPPWPFAQDEERK-QTPDEAKCTYHALAEIYTELGYELVPLPLAPVETRLRFVLADAG....... 181
3 -21.200[F] COG2019 Archaeal adenylate kinase  ali follow..  1........MRSVITGVAGVGKTTVLDIVARESGIPVVNTLMFEVAKRRGLVENRDQIRKLSRETQVDLQKLAGEEIGKMENAIV------DTHMSIKTPFGYLPGLPEWVLRSINASVFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQEFSGATVKIVEEGKPEQAADEIVRVIK....... 181
4 -20.700[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  12  2......LLPNILLTGTPGVGKTTLGKELASKSGLKYIN--VGDLAREEQ---YDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGC------------------DFFPERWFHIVFVLRTDTNVLYERLRGYNEKKLTDNIQCEIFQVLYEEAHQLPSNKPEELENNVDQILKWIEQWIKDHN 171
5 -18.500[F] COG1428 Deoxynucleoside kinases  ali follow..  14  7........KVIVLAGMIGAGKSSYTELIANELGTKAFYEIKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALT--DQNNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLDLLIYLRGSLDTVLSRISLRGRPYEQKHLHSRYDSWFESYDKSDTLVINID-PSDAKYVMQLIHEKLKR.. 214
6 -17.800[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  13  1........MLIAITGTPGVGKTTVAKLLAKKLNYEYVS------LKDFALEKGCGRRVNDEVEVEIDELAYFIERELKGKNAVLDGHLSHLMPVDLVVVLRAHPKLIGERLRERGYD----------------EKIGENVEAELVDAVLIEAIEEHENVIVDTTNKSPEDVVEEIVSLINSGIKKR. 158
7 -17.100[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  11  83........KVICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDDVRNFCLDPSHDLAAQFQIRMYMLRYSQYIDALQSTGQGVVLERSPYSDFVFMEAMFRQSRGARSVYNELRQNHLVIYLDLPVDAVKKQIKARNVDYEVSDLEQLYKQQYLKDISTHAELLIYDWTAETEVVVEDIERIDFNQ. 311
8 -16.900[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  26..........ILLNGGSSAGKTSLALAFQDLAAECWMHIGIDLFWFEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWT------------REWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAEYDFELDTTPVHELARELHESYQA...... 209
9 -16.700[G] COG2074 2-phosphoglycerate kinase  ali follow..  94..........ILIGGASGVGTSSIAFEVANRLGIRNMTDMIREVMRKPPELDEVLIGFRDHVESVSIGVEAVIERALTEGISIVIEGVHIV------------PGFIREDLVNKENVAMFVLTVSDE-RRPLKRYISYFWAIRRIHRYIENQARKHGVPV--IENIDVVTTIDSIIKSLTKTTVK.. 296
10 -16.400[G] COG3265 Gluconate kinase  ali follow..  10  4........KCIIVMGVSGTGKSCVGQALALALGAKFIDDDLHPRANIQKMAAGQPLNDQDRAPWLERLSDVAYSLQQKNEVGFLVCSALKKQY--------------DRLREGNEGIRFLWLTGDYDLVLHRMQQRAGHFMPESLLKSQFATLEAPGSDEPDVIPIDISSSIADVVEHCIAALSLEN 170
11 -16.100[R] COG0645 Predicted kinase  ali follow..  10  4..........AVTHGVSAVGKSQVAMRLVEALGAVRLRDIERKRLEHDRGQFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLK---------QNQRQAACHIAEETGVPFLILAPEAVIAGWLAQRQAEGKDPSDATLDVIRTQQATRE-VQSKRVDTHDAASLDGLVDGIRQRLPG.. 184
12 -15.700[F] COG1618 Predicted nucleotide kinase  ali follow..  15  6...KEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEK---ATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDE-----IGPMELISQSFVSAVEEVLESDKPVLAVLHHSSRHPLAQRFRK---------------------GFEVLTVDKGNRDELPEKITNRFLRKLG... 184
13 -15.100[F] COG0125 Thymidylate kinase  ali follow..  11  6..........ITFEGPEGAGKTTVLQEIKNILGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQLVEKVKPALEQGFIVLCDRFIDSPLAYQGYARGLGIDEVLSIIGDMMPHVTVYFSIDPEEGLKRIYDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVQDVLKVIDEALKKIQ 211
14 -14.400[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  10  18..........IVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDAAAVYRHLEAGDVVIANGSR---------------SALPHFGTAFSRLKVVNIVARPDVLARRLEQRGRESRDDILRRLERSSLAVAGFDVTTVNSGAIEDAGKTIMQVLQQSAGSSQ 198
15 -14.200[R] COG4639 Predicted kinase  ali follow..  13  11..........VVLIGASGAGKSTFARKHFQPFEVISSDFCRGLVSNDENSQSASRDAFDVLHYITTKRLA--------AGKLTVIDATNVQP---------EDRKTLLQMAKQYHCFTVIVFDLPEELCHERNQQRSDRQFGSHVVRRHTQMLRRSLRSFRYVYTLKSPEEIANVAIELQPLWNNKK 176
16 -14.000[F] COG4088 Predicted nucleotide kinase  ali follow..  10  1.......MPLIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTINDESLNIEKETYRESKNEKAARGLLYSAVQRELSKSTFVICDAL---------NYIKGFRYQLYCESKSMYTTHCVIVAVPQDLCRKFNSNKEQPYPDDVLEQLMFRYMTRWDSPLFTVLHDDASCPIDDIWSVLIH...... 178
17 -13.900[G] KOG3354 Gluconate kinase  ali follow..  17..........FVVIGPAGSGKTTMAKAVSEKLGFEYIEDLHPKANIEKMSQGHPLNDNDRWGWLHNCGGACAMELDKESIKGVVLTCSALK-RSYRDILRSSLEHRPAIL-------RFIYLAASRETLIKRTTSRKNHYMKADMVESQLAILEAPTADEKDVITISVENGKEQSEEECLDIVHK.. 185
18 -13.800[R] COG3596 Predicted GTPase  ali follow..  14  40.........VIGIMGKTGAGKSSLCNALFAG--VSDVAACTRDPLRFRLQIGEHFMTIVDLPGVGESGVRDTEYAALYREQLPRLDL-ILWLIKADDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKICLLHELFQPVHPVCAVSVRLQLRVMAERMIKCLPREP 220
19 -13.400[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  11  15..........LIVAGPNGSGKSSVYANADLELEGRSVWIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGV-ETVLSTDKYR---------RLVEAAEAVGFAIWLFYT----------------LDSPERSIERIKLRVAKGGHD---VPADKVRARYARSLDQLPWFLE... 160
20 -13.300[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  18  1.......MPLVVITGLPASGKSTRARQLRDHFGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAG................................................................................................... 84
21 -13.000[F] COG1102 Cytidylate kinase  ali follow..  10  8..........ITVSGLAGSGTTTLCRNLAKHYGFKHVYLIFRQMAKERGMSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVIEGR-MVKNADLKIWLDAPIRVRAERVAKREGISV----------EAFMKIAEREMQNRKRYLNLYGIDINDLSIYDLIIDTSSPEGVFAIVKAAIDHLYEK.. 180
22 -13.000[E] COG4917 Ethanolamine utilization protein  ali follow..  17  1.......MKRIAFVGSVGAGKTTLFNALQG---------------NYTLARKTQAVEFNDKGDIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVI----------------SKTDMPDADVAATRKLLLETGFEEPMFELNSHDQSVQQLVDYLASLTKQEE 150
23 -12.900[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  13  36........LVVFVLGGPGAGKGTQCARIVEKYGYTHLSELLRDERKNPDSKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDKE. 227
24 -12.200[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  12  130..........VGLAGPPGAGKSTVANEVVRRVNKLWPQKAASFDAEVNPPDVAIVLPMDGFRSQLDAMEDPKEAHARRGAPWTFDPALLLNCLKKLKNEGSVYVPSFDHGVGDPVEDDIFVSLQHKVVIVEGNYILLEEGSWKDISDMFDEKW------FIDVNLDTAMQRV------ENRHISTGK 297
25 -11.900[O] KOG0737 AAA+-type ATPase  ali follow..  16  433PLRRPDLCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVR------------ALFTLAAKVSPTIIFVDE--VDSML-MRKIKNEFMTHWDGLMSNAGDRILVLAATNRPFDLDEIRRFESVESREKILRTLLSKEKTENLDFQELAQSDLKN-TTAAYRPVRELIKQEC 641
26 -11.900[H] COG2087 Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase  ali follow..  18  6........RSVFILGGARSGKSRFAEELAGKAGGRLHDEMRDRISHHQERRGGEWTTHEAPVDIATV------QRLDSPDSVILIDTLWLTNLMMENADMETAFAELEAAIVSTRAKLILV---------------------------------SNEVGLGIVPENRMAREFRDHAGRLHQRVAA.. 155
27 -11.800[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  10  8..........VGVSGASCSGKSTLCQLLHAIFEGSSLDDFYKTDAEIPVKNGIADWDCQESLNLDAFLENLHYIRDHGVLPTHLRNRENKNVAPEALIEYADIIKEFKAPAIPTLEQHLVFVDGFMMYVNEDLINAFDIR-------------------MLVTDFDTLKRR................ 153
28 -11.700[R] KOG2486 Predicted GTPase  ali follow..  12  137.........EFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDKWYLVDLPGYGYASAPHELKQDTLVSVFLLVD---------ASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTPIMTSSVTNQGRDEILLHMAQLRNYWLKH.. 318
29 -11.700[E] COG0703 Shikimate kinase  ali follow..  10  71.......KRNIFLVGPMGAGKSTIGRQLAQQLNMEFY-DSDQEIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSR--------------ETRNRLSARGVVVYLETTIEKQLARTQRDKK-HVETPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLE 238
30 -11.500[F] COG0572 Uridine kinase  ali follow..  15  11..........IGIAGASASGKSLIASTLYREL-------------REQVGDQHIGVIPEDGYYKDQSHLSMEERVKTNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIILEGILLLTDIRLRQEMNFSI--VDTPLDICLMRRMKRDVNERGRSMDSVMAQYQKTVR 173
31 -11.500[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  10  14.........KLVLVGDGGTGKTTFVKRLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQIIMFD-------VTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDV------------KERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQ 175
32 -11.500[F] COG0194 Guanylate kinase  ali follow..  48..........IVLSGPSGVGKGTVRQAIFSQED----TKFEYSISVTTRSPREGEVNGVDYFFKTRDEFEQ-----------MIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGK--FIFLAPPSLSELKNRIVTRGTETDENRMKAAKAEIEMMDAYDYVVE-----NDNVETACDKIKAIVLAEH 227
33 -11.300[O] KOG0741 AAA+-type ATPase  ali follow..  12  253.......VKGILLYGPPGCGKTLLARQIGKMLNAREPKVVGPEILNKYVGESEANIR----KLFADAEEEQRRLGANSGLHIIIFDE--IDAICKQRGSMAGSTGVHDTVVNQLLSKI------------DGVEQLNN---MTNRPDLIDEALLRPG-VKMEIGLPDEKGRLQILHIHTARM..... 414
34 -11.200[R] KOG1673 Ras GTPases  ali follow..  11  100......VSLKISLLGDCQTGKTTFVVKYVGDENQSFLEMTGLNLMDKTFYVQGVTISFSDVGGDEKRSKDHIPIACKDAVAILFFD-------LTSRSTLNSVFGWYSQARKWNKTAIPILIGTKF-----DDFVRLPPNLQWTIVTQARAYAKVMNASLFFSSATH-NINVNKIFKFILARLFNLP 270
35 -11.100[R] COG3910 Predicted ATPase  ali follow..  11  39..........TFFAGNNGSGKSTLLEGLAAGMTAY-TVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDIMRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDE...... 228
36 -11.000[O] KOG0728 26S proteasome regulatory complex, ATPase RPT6  ali follow..  14  183........KGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVR------------ELFVMAREHAPSIIFMDE--IDSIGSSRIESGSGGDSEVQRTMLELLNQL-----------DGFEATKNIKVIMATNDILDPALLRPG-RKIEFPPPNEEARLDILKIHSRKM..... 335
37 -10.900[R] COG1159 GTPase  ali follow..  15  11..........IAIVGRPNVGKSTLLNKLLGQ--TSRKAQTTRHRIVGIHTEGPYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLRDGKAPVILAV------------NKVDNVQEKVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPE.. 175
38 -10.900[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  13  131........SILLITGPPGCGKTTTLKILSKEHGIQVQEFKGMFNTESSFHMFPYQSQIAVFKEFLLNKLQMLGDDLRTDKKIILVE----DLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISD---------SLSGDNNQRLLFPKEIQEECSISNISFNPVAPTIMMKFLNRIVTSLELLCQGCS 330
39 -10.800[F] KOG0707 Guanylate kinase  ali follow..  12  130KGVRGNAEKPIVISGPSGVGKGTLISMLMKEFP----SMFGFSVSHTTRSPRSMEMDGVHYHFADKKVMEKE-----------IKDGKFLEFASVHGNLYGTSIESVEAVTDSGK--FIFVCPPSMKELEDRLRARGTETE-EQIQKRLRNAEAEIKEG-LILYNDNLEECYKKLKVNHLLLIAQ.. 324
40 -10.800[O] COG1222 ATP-dependent 26S proteasome regulatory subunit  ali follow..  14  183........KGVLMYGPPGTGKTLMARACASKTNATFLKLAGPQLVQMYIGDGARLVR------------DAFALAKERKPTIIFIDE--IDAIGAKRSDSDQTGDREVQRTMLELLNQL-----------DGFSSSEEVKIIAATNDILDPALLRSG-RKIEFPLPNTLGRKRILQIHARKM..... 335
41 -10.800[R] KOG0394 Ras-related GTPase  ali follow..  14  2.PSRRRTLLKVIILGDSGVGKTSLMNQYVNKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAK----VGTNVEEAFQCIAKDALKSGEEEE 184
42 -10.800[O] KOG0651 26S proteasome regulatory complex, ATPase RPT4  ali follow..  13  185........KGCLLFGPPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIR------------EMFNYARDHQPCIVFMDE--IDAIGGRRFSEGTSADREIQRTLMELLNQL-----------DGFDSLGKVKVIMATNDTLDPALLRPG-RKIEIGLPNEQSRLEILKIHSNKI..... 337
43 -10.800[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  13  377..........IVMLGENGTGKTTFIRMLAGAFVQSEIPEFNVSYKPQGNDSKRECTVRQLLHDKIRDACAHPQFMSDVIRPLQIEQ---LMDQVVKTLSGGEKQRVAITLCLGKPADIYLI---------DEPSAHLDSEQRITASKVIKRFILHAKKTAFIV-----EHDFIMATYLADRVI.... 537
44 -10.700[O] KOG0727 26S proteasome regulatory complex, ATPase RPT3  ali follow..  17  190........RGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVR------------DVFRLAKENAPAIIFIDE--VDAIATARFDAQTGADREVQRILMELLNQM-----------DGFDQTVNVKVIMATNDTLDPALLRPG-RKIEFPLPDRRQKRLVFQVCTSKM..... 342
45 -10.500[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  13  8.....DYLFKTVLIGDSGVGKSNLLMRFTREFNIESKSTIGVEFATRNIVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVLIVYD-------ITKQSSFDNVGRWLKELREHADSNIVIML-----------NKTDLLHLRAVSTEEAQAFAAENNLSFIETSASNVEEAFQTVLTEIFRIVSNRS 179
46 -10.500[S] COG5324 Uncharacterized conserved protein  ali follow..  394..........IFPISVIGCGKTTTSQTLVNLFPDSWG-HIQNDDITGKDK--------------SQLMKKSLELLSKKEIKCVIVDRNNHQFRERKQLFEWLNELKEDYLVYDTNIKVIGVS--------------APYDKLSEIRDITLQRVIKRGNNHQSIKWDELGEK--KVVGIMNGFLKRYQ 540
47 -10.500[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  11  8......AKYKLVFLGDQSVGKTSIITRFMYKFDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVVVYD-------VANRLSFLNTSKWIEEVRNERAGDVIIVL-----------NKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKA-GFNIKPLFRKIAAALPGME 174
48 -10.500[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  12  19......CQFKLVLLGESAVGKSSLVLRFVKQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQIVVYD-------ITNEESFARAKNWVKELQRQASPNIVIAL-----------NKADLANKRAVDFQEAQSYADDNSLLFMETSAKT-SMNVNEIFMAIAKKLPKNE 185
49 -10.500[R] COG1084 Predicted GTPase  ali follow..  13  162.......AFTVVIAGFPNVGKSTLLRTLTAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEDMNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLYLGIR-----VFDIPVVTVFNKMDLAENVKYLEEYINMVEDPLK----------SAFEGRGVSKIIKKLEGLYEKET 329
50 -10.400[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  11  55DPFSTEVKPRILLMGLRRSGKSSIQKVVFHKMSLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLH----LTVTRAYKVNTDINFEVFIH-----KVDGLSDDHKIETQRDIHQRANDDLADAGLE-TSIYDHSIFEAFSKVVQKL........ 237
51 -10.400[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  10  78..IVGRPANNVLMSGARGTGKSSLVKALLHEYADKGLREVDKS-------------------DLIGLPYLLTLLKECPEKFIVFCDSGDETYKALKTALDGGLSQRCANVLVYATSNRRHLMPEYFDENAGTTGMRGEIHQKEAVEEKI-SLSDRFGLW-LSFYPFDQNDYLAAVQNWLEDF..... 243
52 -10.400[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  12  9.....SYIFKYIIIGDMGVGKSCLLHQFTEKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAALMVYD-------ITRRSTYNHLSSWLTDARNLTNPNTVIIL-----------NKADLEAQRDVTYEEAKQFAEENGLLFLEASGENVEDAFLEAAKKIYQNIQDGS 180
53 -10.400[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  15  362........EVLGIVGPNGIGKSTFVKVLAGEIK----PDEGDPGIEVKISYKPQYIKADTPVSVQDFLRGITKRFGTSYYEVEIANPLQLERIY-TELSGGELQRVAIAACLSQEADLYIL---------DEPSAHLDVEQRSMVTKVINRFAENNQKTAMVV-----DHDIYMIDMLSQRLL.... 521
54 -10.400[F] KOG3327 Thymidylate kinase/adenylate kinase  ali follow..  1...........................MNFPERSSSIGQVINSYLTNSKDLPDEVIHL--MFSANRWEHINQVKEKLLEGTTLVVDRYSFSGVAYSAAKGLDFDWCYAPERGLIKPDAVFYLRAPPN-GQYGKERYEKVEFQGRVAEVFNRICSKEGSYFHQFDARQSVEDLAQIASITEELLPKVA 163
55 -10.400[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  12  11......FKFKIVLLGEGCVGKSSLVLRFVEKFSCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNLLVFD-------ITDRKSFEKVKNWVLEIKTCLGNTAEILI-----------NKIDLEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSR 178
56 -10.300[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  12  6.....DFLFKFLVIGSAGTGKSCLLHQFIEKFKQDSNHTIGVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAALLVYD-------ITSRETYNSLAAWLTDARTLASPNIVVIL-----------NKKDLDPEREVTFLEASRFAQENELMFLETSGENVEEAFLKCARTILNKIDSGE 177
57 -10.300[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  13  20.....DYMFKILIIGNSSVGKTSFLFRYADSFTPAFVSTVGIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMILMYD-------ITNEESFNAVQDWSTQIKTYSWDNAQVLL-----------NKCDMEDERVVSSERGRQLADHLGFEFFEASA-NVKQTFERLVDVICEKMSESL 191
58 -10.300[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  11  4.....AYLFKYIIIGDTGVGKSCLLLQFTDRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAALLVYD-------ITRRDTFNHLTSWLEDARQHSNSNMVIML-----------NKSDLEARREVKREEGEAFAREHGLVFMETSAANVEEAFIDTAKEIYRKIQEGV 175
59 -10.200[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  12  19.........RILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNV--EQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSA--------RDRIGISKDELLYMLREEELAGAILV------VLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK 181
60 -10.200[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  12  19.........RILLLGLDNAGKTTLLKQLASEDISHITPTQGFNI--KSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSA--------RKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQ---QSCSALTGEGVQDGMNWVCKNVNA...... 179
61 -10.200[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  16  56........NTVLLSGLSGSGKTVLFYQLRD------------------GSSHQGAVTSMEPNEGTFVLHNENNTKKGKVKPVHLIDVP-----------HSRLISKLEEYLPRAAAVVFVV---------DALEFLPNIRASEYLYDILTNASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKE. 197
62 -10.200[O] KOG0730 AAA+-type ATPase  ali follow..  19  275........KGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLR------------KAFEEAEKNAPSIIFIDEIDSIAPKREKTNGEVERRIVSQLLTLM----------------DGLKSRAHVIVMGATNNSIDPALRRFG-REIDIGVPDEIGRLEVLRIHTKNM..... 424
63 -10.200[F] COG0563 Adenylate kinase and related kinases  ali follow..  13  1........MNLILMGLPGAGKGTQAEKIIEKYGIPHISDMFRAAMKNETELGLKAKSYMDAGELVPDEVTRDRLSQDDCQNGFLLD--------FPRTVAQAEALEDILASLDKKLDYVINIDVPEQLLMDRLTGRRVSPTSGRTYHVIFNPPKVEGI---DVDGSELIQRDDDKPETVKKRLE... 173
64 -10.200[R] COG1160 Predicted GTPases  ali follow..  14  217.........KIAIVGRPNVGKSTLTNRILGEDRVVVMPGTTRDSIYIPMERDGQQYTLIDTAGVRKRGKVHLEKFSVIKTLQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKW---------DGLDQDVKDRVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACAT 389
65 -10.200[O] KOG0652 26S proteasome regulatory complex, ATPase RPT5  ali follow..  15  206........KGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVR------------DAFQLAKEKAPCIIFIDE--IDAIGTKRFDSEVSGDREVQRTMLELLNQL-----------DGFSSDERIKVIAATNDILDPALMRSG-RKIEFPHPTEEARARILQIHSRKM..... 358
66 -10.200[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  12  8......FLFKIVLIGNAGVGKTCLVRRFTQLFPPGQGATIGVGFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANILTYD-------ITCEESFRCLPEWLREIEQYASNKVITVL-----------NKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEAR 175
67 -10.100[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  11  23.........RILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNV--ETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSA--------SNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWN---QPTCALTGDGLLEGLAWLSQNAKL...... 183
68 -10.100[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  15  17..........VLLIGPPGSGKSTFCDTAMRSSHRPWS-RICQDIVNNGKAGT-------------KAQCLKMATDSLREGKSVFIDRCNLDR--------EQRSEFIKLGGPEFEVHAVVLLPAQVCISRSVKRTGHEGNLQGGRAAAVVNKMLQS---FSRIMFCYSDADVDNAVNMYNKL..... 173
69 -10.100[L] COG0470 ATPase involved in DNA replication  ali follow..  11  41..VDEGKLPHLLFYGPPGTGKTSTIVALAREIY----KNYSNMVLELNASDDRGI----DVVRNQIKDFASTRQIFSKGFKLIILDE--------ADAMTNAAQNALRRVIERYTKNTRFCV-----------------NYAHKLTPALLSRCTR--FRFQPLPQEAIERRIANVLV.......... 183
70 -10.100[R] COG0218 Predicted GTPase  ali follow..  27.........EIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDADDVQMYEFLKYYEIPVIIVAT-----KADKIPR----GKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL.... 195
71 -10.100[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  13  46..LEAGHIHSMILWGPPGTGKTTLAEVAANYANAEVERVSA---------------VTSGVKEIRAAIEKARENKLSGRRTILFVDE---------------------HRFNKSQQDAFL------PHIEDGTVTFIGATTENPSFELNNALLSRARYKLTSLNQQEILQALHQAIADTERGLGKVA 190
72 -10.100[R] KOG4622 Predicted nucleotide kinase  ali follow..  30  21..........CVLCGLPAAGKSTFARALAHRLQ.......................................................................................................................................................... 43
73 -10.100[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  20  4.......PLIIGVGGPVGAGKTMLIERLTRYL........................................................................................................................................................... 28
74 -10.100[T] KOG4252 GTP-binding protein  ali follow..  10  8......VAIKMVVVGNGAVGKSSMIQRYCKIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSF-----EAVSSWREKVVAEVGDIPTVLVQ----------NKIDLLDDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLK 174
75 -10.000[O] KOG0733 Nuclear AAA ATPase (VCP subfamily)  ali follow..  17  211..........VLLHGPPGCGKTMLANALANELGVPFISISAPSIVSGMSGESEKKVR------------EVFEEAKSLAPCLMFID----EIDAVTPKRESAQREMERRIVAQFLTCM------------DELSFEKTDGKPVLV-DSLDSALRRAG-REICLTVPSQDAREKILRTMAKGL..... 362

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.