current user: public

If you have questions about the server, please let us know.

Query: [G] COG3265 Gluconate kinase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MSGKCIIVMGVSGTGKSCVGQALALALGAKFIDGDDLHPRANIQKMAAGQPLNDQDRAPWLERLSDVAYSLQQKNEVGFLVCSALKKQYRDRLREGNEGIRFLWLTGDYDLVLHRMQQRAGHFMPESLLKSQFATLEAPGSDEPDVIPIDISSSIADVVEHCIAALSLENHVSAILSELast
1 -88.900[G] COG3265 Gluconate kinase  ali  100  1MSGKCIIVMGVSGTGKSCVGQALALALGAKFIDGDDLHPRANIQKMAAGQPLNDQDRAPWLERLSDVAYSLQQKNEVGFLVCSALKKQYRDRLREGNEGIRFLWLTGDYDLVLHRMQQRAGHFMPESLLKSQFATLEAPGSDEPDVIPIDISSSIADVVEHCIAALSLENHVSAILSE 178
2 -76.900[G] KOG3354 Gluconate kinase  ali follow..  36  13.YKYVFVVIGPAGSGKTTMAKAVSEKLGFEYIEGDDLHPKANIEKMSQGHPLNDNDRWGWLHNCGGACAMELESIKGVVLTCSALKRSYRDILRSSLEHLRFIYLAASRETLIKRTTSRKNHYMKADMVESQLAILEAPTADEKDVITISVENGKEQSEEECLDIVHKMVNENK.... 191
3 -44.200[E] COG0703 Shikimate kinase  ali follow..  16  69AEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGW---VFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKRPLPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN......... 240
4 -40.800[R] COG0645 Predicted kinase  ali follow..  21  1..RFLAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIEQPEHDRGQFAAGIYSSQASEATY-AHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEEFLILDCQAPEAVIAGWLAQRQAEGKDPSVIRTQQATREPLTAAET-VQSKRVDTHDAASLDGLVDGIRQR......... 181
5 -34.100[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  18  1MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDG------YDEEYDCPILDEDRVVDELDNQMREGGVIVDY----HGCDFFPERWFHIVFVLRTDTNVLYERLETRGYN-LTDNIQCEIFQVLEATASYKEEIVHQLPSNKPEELENNVDQILK........... 161
6 -30.100[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  15  1...MLIAITGTPGVGKTTVAKLLAKKLNYEYVSLKDFALEKGCGR-------VNDEVEVEIDELAYFIERELKGKNAVL----------DGHLSHLMPVDLVVVLRAHPKLIGERLRERDREKIGENVEAELVDAVEAIEEHENVIEVDTTNKSPEDVVEEIVSLINSGIKKRVGIVD 163
7 -29.900[F] COG2019 Archaeal adenylate kinase  ali follow..  14  1...MRSVITGVAGVGKTTVLDIVARESGIPVVNYGTLMFEVAKRRLVENRDQIRKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWVVFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQESIFSGATVKIVKNEEGKPEQAADEIVRVIK........... 181
8 -27.600[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  10  22.EGKLILLNGGSSAGKTSLALAFQDLAAECWIGIDLFWFALPPEQLDLARVRPEYYTWD-MHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGVWMVGVHVSDEEGARRELERGDR--HPGWNRGSARAAHA--DAEYDFELDTTATPVHELARELHESYQACPYPMA.... 215
9 -23.000[R] COG4639 Predicted kinase  ali follow..  13  7.ELSLVVLIGASGAGKSTFARKHFQ--PFEVISSDFC------RGLVSNDENSQSASRDAFDVLHYITTKRLAAGKLTVIDATNVQPEDRKTLLQMAKQTVAIVFDLPEELCHERNQQRSDRQFGSHVVRRHTQMLRRSLEKERYVYTLKSPEEIANVAIELQPLWNNKK........ 176
10 -21.700[F] COG1102 Cytidylate kinase  ali follow..  16  4.GCLVITVSGLAGSGTTTLCRNLAKHYGFKHVYAGLIFRQMAKER---GMSLEEAELHPEIDREVDRRQVEAAKECNVVIEGRLAGWMVKN-------ADLKIWLDAPIRVRAERVAKREG--ISVEEAFMKIAEREMQNRKR-DLIIDTSKWSPEGVFAIVKAAIDH.......... 176
11 -21.400[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  16  14.PGTMIVIVGPSGAGKDTLMDYAAAQLS---AGGENHDMHEFNQLEDAGAFAVSWQAHGLKYGIPAAVYRHLEAGDVVIANGS---RSALPHFGTAFSRLKVVNIVARPDVLARRLEQRGRE--SRDDILRRLERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQSAGSSQ.... 198
12 -20.900[G] COG2074 2-phosphoglycerate kinase  ali follow..  14  90.EPLIILIGGASGVGTSSIAFEVANRLGIRNMISTDMIREPPPPELDEVLIGFRDHVESVSIGVEAVIERALTEGISIVIGVHIVPGFIREDLVNKENVAMFVLTVSDENVHKGRFYSRCRQMWARRPLKRYISYFWAIRRIHRYIENIDVVTTIDSIIKSLTKTTVKGGEKGAEKTE 306
13 -20.900[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  15  2.KPAVLWFTGLSASGKSTIANRLEQRLHTYLLDGDNVR-----HGLNSDLGFSDADRVENIRRVGEVARLMADAGLITPVSFISPFREERDQVRARLPEGEFIFIDTPIEECMARAQALRGEIKAFTGIDSPYEPPVAP-----ELRLNTAGRTVDELIAEVENYLAERGVIGSYGSD 181
14 -20.600[F] COG4088 Predicted nucleotide kinase  ali follow..  15  2...PLIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDDESLNIEKETYRESKNEKAARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLKSMYTTHCVIHVAVPQDLCRKFNSNKEQP-YPDDVLEQLMFRYEEPNGMTR-VLHDDASCPIDDIWSVLIHNKNVKPNQATMVKP 192
15 -20.000[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  15  11.QPVFLIVAGPNGSGKSSVYANADLELSVWIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTDKYRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRGGHDVPADKVRARYDQLPWFLERADRAWIWDNSGATPKLIGEK................ 181
16 -18.400[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  14  33MKPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGK---NRESLEKRIQTYLQSYEEMGKVKKIDASKSVDEVFDEVVQIFDKE......... 227
17 -18.300[F] COG1428 Deoxynucleoside kinases  ali follow..  18  4VGNKVIVLAGMIGAGKSSYTELIANELGTKAF--ESIKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDTYLDLLDNMMEELLLIYLRGSLDTVLSRISLRGRPYFDNPGLLDYYKHLHSRYDSKSDTLVINIDEDAKYVMQLIHEKLKR.......... 214
18 -18.200[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  19  114.KGCVVWITGLSGSGKSTVACALSKALLTYTLDGDNVR-----HGLNRDLTFKAEHRTENIRRIGEVAKLFADVGVICIASLISPYRRDRDACRSLLPDGDFVFMDVPLHVCESRKLARAGKIKGFTGIDDPYEAPVNCE--VLKHTGDDESCSPRQMAENIISYLQNKGYLEG.... 293
19 -18.100[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  15  2...PLVVITGLPASGKSTRARQLRDHFKVHLISENEAVPKAGFGKNSH----DSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELKVSRTTQCTVFTCIPQEEAWTFNSQRTAP-YTRETFDALCQRYEEPQSNNRDSPLVVVLPKDTLDMEAIYKALYESQPLPPNQST 202
20 -17.900[F] COG0283 Cytidylate kinase  ali follow..  15  1MNRQKVIAIGPGASGKGTVAARVAAALGYDYLDTGALYRLTALYAQKQGVGWHDEENVSELEDVSDGITEAIGMGASAVAQLPKVRASLLQRQRDFLTEKGLVFLTAESKIRAERRAKQPCEGLAFERILSDIEARDPLKQQPDALLLDTSRLTIEETVKKVLDWYRK.......... 217
21 -17.000[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  13  13.KQIVVLLIGPPGSGKSTFCDTAMRSSHRPWICQDIVNNGKAGTK----------------AQCLKMATDSLREGKSVFIDRCNLDREQRSKLGGPEFEVHAVVLELPAQVCISRSVKRTGHERAAAVVNKMLQSKELPKVNESRIMFCYSDADVDNAVNMY................ 170
22 -16.700[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  19  1MTRKTIIVSGASCSGKSTLCQLLHAIFGSSLVHEDDFYKTDAEIPVKNGIADWDCQESLNLDAFLENLHYIRDHGEQHLVFVDGFMMYVNEDLINAFD----LMLVTDFDTLKRRREARTGYITLEGFVWPGYVHGHSHLFVNGDVTGMSVRDNVQWAINSILNALQ........... 230
23 -16.400[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  10  9...RTVAILGGESSGKSTLVNKLANIFNTTSAW-EYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQ-QALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVREMMGEQR........ 187
24 -16.300[R] KOG4622 Predicted nucleotide kinase  ali follow..  17  20....LCVLCGLPAAGKSTFARALAHRLQIGVVAYDDVMPDAFLAGARARPAPSQWKLL---QSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVRKYSLGFCQLFLDCPLETCLQRNGQRPQA-LPPETIHLMGRKLEKPNPEEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAE 255
25 -16.200[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  12  64.KDKVVVILGATGAGKSRLSVDLATRFPSEIINSDEITTNQITLQDRRGVPVINPEHGELFRSAASNVVKEITSRQKVPIIAGGSNSFVHALLAQRRYECCFIWVDVSETVLYEYLLRRVDEMMDSGMFEELSRFYDP........................................ 236
26 -15.000[C] COG3954 Phosphoribulokinase  ali follow..  11  4.KHPVIAVTGSSGAGTTTTSLAFRKIFAAAEVEGDSFHREHTFIEYGQTGKGTYDEAVPWNQVPGTFTPWQPLPEPTDVLFYEGLHGGVVTPQHDVARHVDLVGVVPIVNLWIQKLIRDSERGHSREAVMDSVVRSMDPQFSRTHINF.............................. 205
27 -14.100[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  15  81.NSKVICVEGPIAAGKSKFAKELAEELDMEYYDMRKLDPQLPPSCRSYDVRNFCLDPSH-YSQYIDALQHVLSTGQGVVLARSVYNELRQNTIGELLKPHLVIYLDLPVDAVKKQIKARNVDYFSDAYLSDLEQLYKQQYLKDISIYDWTAGGETEVVVEDIER.............. 306
28 -14.100[F] COG0572 Uridine kinase  ali follow..  16  7.QCVIIGIAGASASGKSLIASTLYRELREQVIPEDGYYKDQSHLSMEERVKTNYDHPSAMDHNLLLEHLQALKAGKPVVIILEGILLLTDIRLRQEMNFSIFVDTPLDICLMRRRDVNERGRSMDSVMVRPMFLQFIEPSKQYADIIVGKNRIAIDILKAKISQFFE........... 213
29 -14.000[F] COG0563 Adenylate kinase and related kinases  ali follow..  16  1...MNLILMGLPGAGKGTQAEKIIEKYGIPHISTGDMFRAAMKNEMDAGELVPDE-----TIGIVRDRLSQDDCQNGFLLDGFPRTVAQAEALEDILASLYVINIDVPEQLLMDRLTGRR----KPETVKKRLEVNQKQYSEKGYLQNINGDQDISRVFEDINELLKG.......... 214
30 -13.900[F] KOG3078 Adenylate kinase  ali follow..  17  14.KGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGMDAGKLVSDE-----VVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRSVIEFSIPDSLLIRRITGRLIHP-NEKALKIRLQAYHTQYRKRGIHSAIDASQTPDVVFASILAAFSKATS....... 232
31 -13.700[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  14  126.LKRLVGLAGPPGAGKSTVANEVVRRVNAIVLPMDGFHEDPKEAHARRGAPWT--DPALLLNCLKKLKNEGVSLQHKVVIVEGNYILLEEGSWKDISD--EKWFIDVNLDTAMQRVENRHSTGKPPDVAKWRVDYNDRPNAE----LIIKSKTNADLLIRSM................ 331
32 -13.500[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  13  64.GLILVGLAGPSGAGKTIFTEKILNFMPIAIINMDNYNDGDNIHGLRDGVPIYD------FKSSSRIGYRTLEVPSSRIVILEGIYALSEKLRPLLDLR---VSVTGGVHFLVKRVLRDIQR--PEEIIHQISETVYPPDLKTAQIKILNKFNPFSGFQNPT................ 250
33 -13.500[S] COG5324 Uncharacterized conserved protein  ali follow..  13  390.TKFLIFPISVIGCGKTTTSQTLVNLFSWGHIQNDDITGKDKSQLM-----------------KKSLELLSKKEIKCVIVDRNNHQFRERKQLFEWLNNIKVIGVSEIRDITLQRVIKRNNHQ--VGIMNGFLKRYQPVNLDKSP-LDFGQADSSLTNAKQILNEIHK.......... 579
34 -13.100[F] COG0194 Guanylate kinase  ali follow..  14  44.RGLLIVLSGPSGVGKGTVRQAIFSQEDYFFKTRDEFEQMIADNKLLEWAEYVGN----YYGTPVDYVEQTLQDGKDVFLEIE--VQGALQVRNAFPEGLFIFLAPPSLSELKNRIVTRGTE--TDALIENRMKAAKAEIEMMDAYDYVVENDNVETACDKIKAIVLAEHLKRERVAP 235
35 -13.000[R] COG3911 Predicted ATPase  ali follow..  7...RVFVLTGGPGSGKTTLIAALRRAGFATSVVAGRGIVRDQSSIGGTALPWSDRTLAELMLSWEMRSYQNAVEQKGPVFFDRGVPETL-STAAKRFRYNPRVFIAPPWPDIFAQDEERKQTPDEAKCTYHALAEI---YTELGYELVPLPLAPVETRLRFVLADAG........... 181
36 -12.100[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  57....HVLIFGPPGLGKTTLANIIANEMGVNLRTTSG---AAMLTNLEPHDVLFIDEIHRLSPVVEEILYPAMEDYQLDIMIGEGPAAR---SIKLDLPPFTLIGATTRAGSLTSPLRDRFGIVQREHIVSRSAKCLGLELTPEGAHQLARRSRGTPRITNRLLRRV............ 230
37 -11.900[F] KOG0707 Guanylate kinase  ali follow..  12  136.AEKPIVISGPSGVGKGTLISMLMKEVHYHFADKKVMEKEIKDGKFLEFASVHGN----LYGTSIESVEAVTDSGKRCILDID-------RSVRASSLDAIFIFVCPSMKELEDRLRARTEEQIQKRLRNAEAEIKEGISSGIFGLILYNDN--LEECYKKLKVNHLLLIAQ...... 324
38 -11.700[S] COG1806 Uncharacterized protein conserved in bacteria  ali follow..  16  148LDQAQVILLGVSRCGKTPTSLYLAMQFGIR----------------AANYPFIADDMDN------LTLPTSLKPLQHKLFG-----------------------LTIDPERLIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYSVEEIATKILDIMGLNRR....... 275
39 -11.600[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  18  1.....MFIVAVTGTGKSTISKVFER-QGIPVIDADKLLPSKEINRAVLGKMIFEDKELPTIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGVLMDFIHKIVCVTC--DSDKQLERLIARNE---ARHRVDSQMPLDKKCEKSH---FVIDNNGSVEEAESSAMSIYNL.......... 195
40 -11.300[J] COG0324 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  12  1MKPTAIFLMGPTASGKTDLAIQLRSQLPVEVISVDSALIYKGM-DIGTAKPSKEELAL--FRDDALREMADITAQGKIPLLVGGTMLYYKALIEGLSP------LPSADENIRAELEQKAAQ-QGWAALHTELAKIDPISAARIN----------PSDSQRINRALEVFYITGKSLTE 177
41 -11.000[R] KOG2878 Predicted kinase  ali follow..  15  24.RPFILGISGPQGSGKSTLASALDTELTVVKFSLDDFYEQVELAKNNPNNPLVQHRGLAGTHDVTNNVLNAFVKGSDEEVSIPFYDKSKFGGYKANPKTTTYVIFEG....................................................................... 150
42 -10.900[R] COG4240 Predicted kinase  ali follow..  14  87.RPFIQGILGSQGTGKTTMSLVIQLILQTLSLSLDDLYTYSDRLVLLQQDPRLIWRGPPGTHDIDLNVLEQIRQGKSPILIFEGWFVGVRPIDPSLFNFPPSPILTDEDKAFARDMNLRLNHYLPLWEKLDSLILLYPTDQAEQKMIAAGKTGMSNTQIEEFVNYF............ 295
43 -10.900[R] COG1660 Predicted P-loop-containing kinase  ali follow..  13  5.HINLVIVTGMSGAGKTVAIQSF-EDLGYFTIDNPKFLELIEQTNENRRVALVVDMRSRLFFKEINSTLDSIESNPSIDFR--------------------ILFLDATDGELVSRYKTRRSHPLAAD---RLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGSNQASFR.. 169
44 -10.900[H] COG0237 Dephospho-CoA kinase  ali follow..  20  1....MTLVIGLTGSGKSTVANMLIE-KGITVIDADIIAKQAVEKGMPAGEDILLSNGDIDRKKLGALVFTNEQKRLNAIVHPAVRQEMLNRRDEAVANREAFVVLDVTKELQLERLMKRNQ---AVSRIRSQMPLEEKTARAD---QVIDNSGTLEETKRQLDEIMNS.......... 195
45 -10.900[H] COG1072 Panthothenate kinase  ali follow..  16  79.IPYIISIAGSVAVGKSTTARVLQALLSVELITTDGFL-KERGLMKKKGFPLKSGVPNVTAPVYSHLIYDVIPDGDKTILILEGLNVLQSGMDYPHDPH-FSIYVDAPEDLLQTWYINR........................................................... 235
46 -10.800[F] COG0125 Thymidylate kinase  ali follow..  16  1MSGLFITFEGPEGAGKTTVLQEIKNILTAEGLQV--------ATREPGGIDIAEQIREVILNENNILM----DPKTEALLYAAARRQHLVEKVKPALEQGFIVYFSIDPEEGLKRIYANGSR--EKNRLDLE-GYQELMKRFPERFHSVDAGQSKDLVVQDVLKVIDE.......... 205
47 -10.700[R] COG3910 Predicted ATPase  ali follow..  17  34FKTPITFFAGNNGSGKSTLLEGLAAGMTAY-VKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFLDPESPLSELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITERLYDE 238
48 -10.600[R] COG2229 Predicted GTPase  ali follow..  14  1MRENKIIFTGPVGVGKTTAIAAISDQTDASASDMTLDRKRNTTVAMDYGVHLYGTPGQERFNFMWEILSQGSM---GLVLLLDNARTNPLKDLEFFLHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPGLE........... 177
49 -10.600[K] KOG1534 Putative transcription factor FET5  ali follow..  14  1MVKVAAFVCGVASSGKSTFCGALMSYMSCHLVNLD---PAAENFEWEPTVDIRD------LISIDDVMEELDYGPNGGLIYCFEFLMENNEEIGDYDEDYLIFDMPGQIELLIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVMMEVPHINLLSKMD........... 176
50 -10.400[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  11  26.SGQLVVVLGPSGCGKTTLLNLIA-----------GFMTPSAGVITLDNIPVSGPSAERGVVFQNEGLLPWRDVVSNVEFGLQLAGMSKEQRRVTALKMLNRVGLAGFEHHFIWQLSGGMRQRVGIALLDEPFGALDAFTREQMQELLLTIWRDTGKQILLITHDIEEA......... 192
51 -10.100[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  17  31.KPAKVMIIGDVDTGKTTLTIYLANELRVAIIDSDGILPPATISLAFVDSHFTNQYFGEMVVGVMKLSELAMKFSDVVLIDTTGGVELKRMKIEAVKPN-LILALERNNEL................................................................... 171
52 -10.100[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  24  2..KQVAVISGKGGTGKTTFSATIHALEGGVVADCD............................................................................................................................................... 34
53 -10.100[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  16  47.ENEFVAIVGPTGCGKSTLLNAVA-----------GLLTPASGTVEISGQRLQGLNRKAGYLFQQDALMPWKTVLENVAIGLEIAGTPKAKAREQAREWLNKVGLGTFGDRYPHMLSGGQRKRVGLALMDEPFGPLDAQTRVIMGDLLLDLWSQDKKAVMFVTHDLEEA......... 213
54 -10.000[O] KOG0741 AAA+-type ATPase  ali follow..  13  256.....ILLYGPPGCGKTLLARQIGKMLNAREP------------KVVNGPEILNK----YVGESEANIRKLFADAEEEQRRLGA------------NSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGV-EQLNNILVIGMTNRPDLIDEALLR.............. 385
55 -10.000[R] KOG1533 Predicted GTPase  ali follow..  14  31WTMYGVLVIGAPGAGKSTFCAGLTDIFPFLTINLD---PANDTMAYAPDVNITE------MITVNDVMDRLGLGPNGALKYCIETLGANLQKIEANHKKYLIIDCPGQLELVIRFLEKSGVRLCALHLADSLYCS........................................... 174
56 -9.770[O] KOG0733 Nuclear AAA ATPase (VCP subfamily)  ali follow..  16  207.PPRGVLLHGPPGCGKTMLANALANELGVPFIS--------------SAPSIVSG--------------------------SGESEKKVREVFEEAKSLAPCLMFIDEIDAVTPKRESAQREMERRAQFLTCMDELSFEKTDGKPVLVIGATNRPDSLDSALRR.............. 333
57 -9.760[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  16  90.ANCLATVYGMSGVGKTKAIQEFAKSHANVWLSPSRSSLSEILYEIALELGISDAPRRK--GTLSRLIARKIKGTEGLLIVDEALPYEALEELRIMQEEAGIGLVLVGNDKVYTRMKGGISPSHEYARLWSRVASIQKTKKADTQAVAQAWGLETDEEALKVMQSITET......... 263
58 -9.740[O] COG1219 ATP-dependent protease Clp, ATPase subunit  ali follow..  18  111LGKSNILMIGPTGSGKTLLAETLARLLNVPFTIAD-QKCDYDVEKAQMGIVYIDETRDVSGEGVQQALLKLIEGTVASVPPQGGRKHPQQEFLQVDTRNILFICFAGLERVIQNRSARGG.......................................................... 267
59 -9.710[L] COG2812 DNA polymerase III, gamma/tau subunits  ali follow..  15  38..SHAYLFSGPRGTGKTSAAKIIAKAINCE-PIAEPCNECRACKGITSGSIVD-------------------------VMEIDAASNNGVDEIRDIRDHVKFAPSEVRYKVYI-----DEVHMLTTGAFNALLKTLEEP----SHAIFILATTEPHKIPLTIISRCQR.......... 172
60 -9.670[D] COG3640 CO dehydrogenase maturation factor  ali follow..  12  4FGMPKLIISGRGGSGKSTLVTLIAHTLKVLVVDSD------SNIGLSGILGIEPAEKT--LMDYLGGKPRVMKKLRSMIRDGETEPELFREKFDLESLSQEFVCWVGSLGLMQIGKIDHAMEGCACPMGAVTRDFLNHVRLEEDQWVLVDTEAGVEHFGRGIVEGAD........... 168
61 -9.610[U] COG3267 Type II secretory pathway, component ExeA (predicted ATPase)  ali follow..  13  46.....AMLTGEVGTGKTTVARAILASLPAGMILNPTFSDLELLEAICDEFEVSKATLKKLTQVLHEFLLAEHAQGIQVLLMIDEAQHLAPDVLEQLR---LLTNLETESHKLLKVLLIGQPE-LQEKLRLPQLRQLAQRITGRYHLLPLNEEQTADYIRFRI................ 205
62 -9.380[R] COG1223 Predicted ATPase (AAA+ superfamily)  ali follow..  10  135..PKNVLFYGPPGTGKTMMAKALSNEAKTPFL--------------------------------------SVKSTKLIGEHVGDGARRVHELYERARQLAPCIVFLDEFDAIALDRGYQEIRGDVSEIVNALLTELD--TNSNEGICTIAATNRVELLDASIRSRFEEE......... 262
63 -9.370[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  11  129.GGSILLITGPPGCGKTTTLKILSKEHGIQVQELPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRDLRTDKKIILDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRISNISFNPVAPTIMMKFLNRITVPDKTSLELLCQGCSGDIRSAINSL................ 340
64 -9.320[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  13  82.PANNVLMSGARGTGKSSLVKALLHEYGLRLIE----VDKSDLIGLPYLLTLLKECPEKFIVFCDDLSFESGDE------TYKALKTALDGGLSQRCANVLVYATSNRRHLMPEYFDENAGTTGMRGEIHQKEAVEEKISLSDRFGLWLSFYPFDQNDYLAAVQNWLED......... 242
65 -9.250[T] COG1493 Serine kinase of the HPr protein, regulates carbohydrate metabolism  ali follow..  29  144IYGIGVLITGSSGVGKSETALDLVRR-GHRLVADD............................................................................................................................................... 177
66 -9.230[F] COG1618 Predicted nucleotide kinase  ali follow..  13  9.TMLRIAVTGSPGVGKSTVVAKTAEKLAEK---GGIRTAEIRKEGHREGFSIRDLATGK--TGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIMELISQSFVSAVEEESDKPVLAVLHHSSRHPLAQRFRKGFEVLTVD-KGNRDELPEKITNRFLR.......... 181
67 -9.220[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  6....IIGVGGPVGAGKTMLIERLTRYLSMAAITNDIYTKEDARILLNTSVLPADRIAGV-NFAAIEEMCDKHPDLQLLFLESGGDNLSATFSPDLVDFSIYIIGMIKSDLFIINKVDLAPYVGANVEVMKADTLKSRG------NKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE. 206
68 -9.210[F] KOG3327 Thymidylate kinase/adenylate kinase  ali follow..  13  6..............RSSSIGQVINSYL----TNSKDLPDEVIHL-------MFSANRWEHINQ----VKEKLLEGTTLVVAYSAAKGLDFDWCYAPERGLAVFYLRAPPNDLTHRGQYGKERYEKVEFQGRVAEVFNRICSKEGSFHQFDARQSVEDLHAQIASITEE.......... 157
69 -9.170[L] KOG1968 Replication factor C, subunit RFC1 (large subunit)  ali follow..  11  408.LYKAVLLSGPPGIGKTTAAHLVAKLEGYDVLESDTRSKRLLDEQLFGVTDMDEIDGMS--GGVGQLNMIIKKSMIPIICICN----RAHPKLRPLDRTTFDLRFRPDANSMRSRIMSREGLKLSPQAVDQLVQGTQ---------------------MRQIINLLSTYKLSCSEMT. 595
70 -9.110[O] KOG0737 AAA+-type ATPase  ali follow..  17  447.PCRGILLFGPPGTGKTMMAKAIANEAGASFIN-----------------------------SMSTITSKWFGEDEKNVRALFTLAAKVSP---------TIIFVD-EVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNAGDILVLAATNRPFDLDEAIIRRFERR......... 577

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.