current user: public

If you have questions about the server, please let us know.

Query: [K] COG3355 Predicted transcriptional regulator, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MAEKVRFPDGREVDIHDFIAFMYGLSKSDVEVLHILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKEERKGRPNYIYWVEKERLYRKLEADLEKLAGTVKEALQKHTALEIVILast
1 -54.400[K] COG3355 Predicted transcriptional regulator  ali  100  1MAEKVRFPDGREVDIHDFIAFMYGLSKSDVEVLHILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKEERKGRPNYIYWVEKERLYRKLEADLEKLAGTVKEALQKHTALEIVI 127
2 -37.000[K] COG1846 Transcriptional regulators  ali follow..  15  38......................GALTPSEIHTIDAIGTDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVSRGIQVVLTDKGREAYRAHADMHAAFYEELQQSFTKEEIAIFEQCV.. 140
3 -24.300[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  16  1........................MKMKTLFLLIKLAKMGTVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRE---SRKGTLVELTEKGINLLEKLYEEISTALYSGFIVGEVISGIGEGAYYV. 105
4 -23.900[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  12  54VEYGLILASHAFSRWMVRCMAAAGLSPIEILILHSIRHRREKKLADICLALDIDTHIATYAIRKLEKAGLLTTGK---AAKEKTVKITAKGAEACAHYAQIRERLLVDSTANARPSEETLSELAALL 182
5 -23.200[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  19  13..................LLKAIGLKKNEIRIYRLLVERRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQSGWLGYIYTP-----VSPLEILQKIKEHLMKSIEELERDLKN........ 109
6 -22.700[K] COG1510 Predicted transcriptional regulators  ali follow..  12  8...IIEHAEEHLIEKIAENMHTFGMPSTVGRVLGIIYNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRKDLYDVEQDYYQTFISLFAANWTKVVSKNKVLYKKLNRE........ 124
7 -21.700[K] COG4738 Predicted transcriptional regulator  ali follow..  28..................LLRRLNINRPVALTLACLSKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNHGKGRPVKLYKLTVQMETIIDTIEENVIAESKTILQNIER........ 128
8 -21.100[S] COG2469 Uncharacterized conserved protein  ali follow..  12  174.ETTMDMLQEYIQNFIEKSKPKEKLSEVEEQILTMVYT--GVDSVSVESILGVTTEELNKMYDRLVNLGLARV-----VKIRKEIELTPRGVALVSEIMKKAAR....................... 269
9 -18.800[K] COG4190 Predicted transcriptional regulator  ali follow..  15  67........................LTPRVLELIEAIRQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQRKR.............................................. 123
10 -18.300[K] COG2345 Predicted transcriptional regulator  ali follow..  18  15.........................GDTRRKILLILLERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPRQNPYEP............................................ 72
11 -17.100[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  15  9..................ILRSLNRSELRRKVLFYLLSIYPSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVE--QSKNGFKYFKINPEIVEEVRNMKNMFSDKKVYTVE................ 111
12 -16.900[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  11.............................LYLALLVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDGRRH.............................................. 62
13 -16.600[K] COG1522 Transcriptional regulators  ali follow..  20  1...................MSKVELDKIDRKILEVLQSNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIRQYAALLDPGK............................................. 63
14 -16.100[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  14  13........................NDYDMLRVLKHFTIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDY...................................................... 61
15 -16.000[K] COG1497 Predicted transcriptional regulator  ali follow..  12  9.........................ELTRFQILSEIAMRQPVRQKDIADKLGVTVQAVSENIKSLIAEGLVESG-----SGRSHYKITRRGAEKIKEAAMDLRRYADEVLESMSFYRSV........ 98
16 -15.400[K] COG1777 Predicted transcriptional regulators  ali follow..  17  14.........................NSTRREIIRMLTQFERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPSSV.............................................. 69
17 -15.200[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  32  246........................LSPELCEVLDIIRGHKGITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLRNGREN............................................... 302
18 -15.200[K] COG4742 Predicted transcriptional regulator  ali follow..  22  12.........................SQKRRDLLLLL-GEEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNG................................................... 61
19 -15.000[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  20  5.............SIFREIINDMDTLKRHISVINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSR.................................................... 66
20 -14.900[K] COG1378 Predicted transcriptional regulators  ali follow..  17  29..................VLKRLGFRDYEARVYATLATRGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETIKS---------SPAVFRAIDPESVLEEYKEQLVSAVDTAIRSIRE........ 120
21 -14.800[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  25  27...............................ILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLADYVRRRDDETG---WMEYYWRINYDKALDVLKRELEKTAKKLREKIEAETSTIYYI 119
22 -14.600[K] COG1414 Transcriptional regulator  ali follow..  16  21.............................LDILELLASVDGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDRYSLTLKLFGLAQLHAPVRRLASFATPFMRELADRSKQA........... 108
23 -13.900[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  21  185.........................NATNQRIISEIQNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDETRS................................................... 235
24 -13.400[K] COG3682 Predicted transcriptional regulator  ali follow..  22  1......................MHITAAEAHVMEALWRRSPLSADELVAEVGAAQATVKTLINRLLKKKAIKSERA................................................... 58
25 -13.200[K] COG4189 Predicted transcriptional regulator  ali follow..  23  22.........................SLIRVQILKLLHEANGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLRTETRKARKGSQKI.......................................... 81
26 -12.800[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  15  5........................HTDRIEEYLETILYQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPYQGVELTEKGAEEAVRIKRKHQVLEEAHREACELEHAVSDSVLERLYDFL.. 122
27 -12.700[K] COG3432 Predicted transcriptional regulator  ali follow..  12  33.........................KRGTMEIMFDILREPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKT---ENDRKIYEITEKGKLEFIKIRENLYSAKEKVSELLRTDSE......... 130
28 -12.600[K] KOG2593 Transcription initiation factor IIE, alpha subunit  ali follow..  14  5VAKTFYDNYTPKNNNQKKSAKNG-SGGIAVLVLDALTRRQWVREEDLAKELKLNTKQLRTILRYFEEQQFIMRVHRKEKSSKVKVHMYSYCCLDYSQIYDVIRYKLHRMKKEFKDVLEDK....... 132
29 -12.500[KG] COG1349 Transcriptional regulators of sugar metabolism  ali follow..  30  9..............................AILEHLQKQGKCSVEELAQYFDTTGTTIRKDLVILENAGTVIR...................................................... 51
30 -12.400[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  11  143........................FTPKRAQVVCVLLDAPQLPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGS................................................... 197
31 -12.300[T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  ali follow..  18  133LAFDLTWIAASEERMLDNHLLSIGRRTAIERAAYLIAF--PVTQQHVADTLGLSIVHTNKTLRKLVDRGLIR....................................................... 219
32 -12.200[K] COG1654 Biotin operon repressor  ali follow..  22  9..............................TLISLLADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGV......................................................... 48
33 -11.500[J] COG4901 Ribosomal protein S25  ali follow..  16  52..............................AIAKEVQNMRVITPYEIASKYGIKMSVAFKVLRNLKERGDLVL...................................................... 94
34 -11.400[K] COG0640 Predicted transcriptional regulators  ali follow..  16  1...........................................MNEITMQTQADQPKVSSNLAILSEARLVDSIQMGREK............................................... 37
35 -11.000[K] COG1695 Predicted transcriptional regulators  ali follow..  14  1........................MDRYAIKALVLLSKKLYQMSKEISTGVQVSHGTLMPMIRKLLQERYIDFE---TRGREKVYHLTERGSRFVESLGKIEEDVKQNLIS................ 87
36 -11.000[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  21  23.........................SEVKRKLLLDLST-GWITLPVIEQKYG---KEGRRALLYLDKIKMIETQWITGQN............................................... 73
37 -10.900[K] COG3888 Predicted transcriptional regulator  ali follow..  25  6..............................VLLRELKRARGIDQFQIEEMMGFSKSTVSEALKDLEEKGIIKRR..................................................... 51
38 -10.900[K] COG5340 Predicted transcriptional regulator  ali follow..  28  13.......................GLSTRESRLLSHLAAEG-ISIDDVEATLEVAPNTAREIASRLTEKGWLDR...................................................... 64
39 -10.600[K] COG2188 Transcriptional regulators  ali follow..  24  36..........................................SENELVASLGVSRMTVHRALRELTAAGFLIRLQ.................................................... 68
40 -10.300[K] COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain  ali follow..  11  13................................VAQMYFSEHKRQAEIAQHLNLSQATVSRMLKRAEAEGIVRTSIIPPPGTYSDLQLRERFDLPEAIVVDCSEDRDGAIMARIGEAAAHFLEVTL.. 107
41 -10.000[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali follow..  30  6........................LTKNQSLVMGALAHDGPMSAYTILDKLRDNPLQVYRALDKLLEYGLVHR...................................................... 59
42 -9.850[K] COG2378 Predicted transcriptional regulator  ali follow..  20  27.............................FEIIQILLARRPVTAQTIADMLEVTARSVYRDIAALQTMRVIEGERSIEETEAIVLALAMVDRSGDAELRQAAKKVSDKIAASLPEPLSKTLSANAL. 142
43 -9.800[K] COG1725 Predicted transcriptional regulators  ali follow..  24  36..........................................SVREMGVKLAVNPNTVSRAYQELERAGYIYAKR.................................................... 68
44 -9.760[K] KOG3233 RNA polymerase III, subunit C34  ali follow..  18  87.......................GSDNQEKLVYQIIEDAGGIWSRDIRYKSNLPLTEINKILKNLESKKLIKAVKSVAASKKKVYMLYN--LQPDRSVTGGAWYSDQDFESEFVEVLNQQCFKFL.. 188
45 -9.590[K] KOG2587 RNA polymerase III (C) subunit  ali follow..  13  366....YKSIISVAQKDEAVVMRRYGKEAF--RMFRYLSQEGRVETDKIADAALTEKKDTPQFLLKMWKDGYLHMQKLAVTAPGMY-TPFLLWKVNKLIVTTQMLDEMYHASLNLSLRLAHELEAEKEL 486
46 -9.560[J] KOG1767 40S ribosomal protein S25  ali follow..  21  50..............................KLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAKGVIR....................................................... 91
47 -9.550[S] COG1356 Uncharacterized protein conserved in archaea  ali follow..  21  5........................LTEQQIKVLVLRAK--GLKQSEIARILKTTRANVSILEKRALEK........................................................... 46
48 -9.500[K] COG5111 DNA-directed RNA polymerase III, subunit C34  ali follow..  14  82.......................TMEGDEQIVYSFIKNSGGIWRKTLTLRTNLHVSVVDRCLKSLESKNLVKSIKSVKNPTRKIYMLYD--LVPSTELTGGPWFTDQELDVEFIENLKKVIYRYV.. 183
49 -9.400[K] COG1733 Predicted transcriptional regulators  ali follow..  15  12..................LSMAAEVLCTRWTMVLM-LVAGSTRFNDLRRGVKMSPTLLSQRLKELELAGIVERKEVPGEKGIFDYRLTEAGRDLRPVVEA........................... 95
50 -9.350[S] COG3177 Uncharacterized conserved protein  ali follow..  10  298........................INEDEAKILRFAVEQREFKAGDLAKLFSMNANQRTYQIKKLVESGFISPLEENSRIYIPNFSQSYLIRGVIYALREN.......................... 375
51 -9.250[J] KOG2784 Phenylalanyl-tRNA synthetase, beta subunit  ali follow..  11  43.EHLERWFQHLSSFEMTAETDVRSTENLPQQILDFLQESNEFNSIQLAQQWNLDHQKVIGAIKSLLAEGVLT-----KDVTEKRLELTNEGVQFANE.............................. 135
52 -9.120[KT] COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases)  ali follow..  24  4........................LTEAQQELYEWLAEY-SPSIRQMMQAMNLSPAPIQSRLEHLRTKGYIEWTEGKA................................................. 63
53 -9.070[R] COG1342 Predicted DNA-binding proteins  ali follow..  16  38........................LTVEELEAL-RLVDIEGLRQEDAASRVGISRRAFWEDLKSARMK........................................................... 80
54 -9.030[R] COG1672 Predicted ATPase (AAA+ superfamily)  ali follow..  13  213LLEYLRSDSLLYQDAFFVLREELEEPRNYFAIMEAV-AAGKTSLGEIMNETGLSRATVAKYLSVLIELDFVKREIPITASRKSR........................................... 295
55 -9.020[K] COG1802 Transcriptional regulators  ali follow..  19  30...................................FTPGERLIERELCETLGVSRTSIREALRRLEAEKLVSIVPH---KGPIVAIISRQEAAELFALRGLLEGFAAREFQRATDVAIVHFAQAI.. 117

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.