current user: public

If you have questions about the server, please let us know.

Query: [S] COG3388 Uncharacterized protein conserved in archaea, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MKEYSIFREIINDMDTLKRHISVINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSREGAILTPDFIEHKEQIIADAEKVLEEATKIAEDVRKMLEKKLast
1 -52.800[S] COG3388 Uncharacterized protein conserved in archaea  ali  100  1MKEYSIFREIINDMDTLKRHISVINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSREGAILTPDFIEHKEQIIADAEKVLEEATKIAEDVRKMLEKK 107
2 -31.200[KG] COG1349 Transcriptional regulators of sugar metabolism  ali follow..  18  1.............MKPRQRQAAILEHLQKQGKCSVEELAQYFDTTGTTIRKDLVILENAGTVIRTYGGVVLNKEESD--PPIDHKTLINTHKKALIAAAAVKYIHD. 91
3 -23.600[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  15  1...MSEYEKEIDELINDYDMLRVLKHFTIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNTS-IKRTEAKLKKSAEVHKHHTYYQINKKAEAVLKEITPK 103
4 -18.300[K] COG4190 Predicted transcriptional regulator  ali follow..  18  67...............LTPRVLELIEAIRQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDG....................................... 119
5 -17.700[K] COG2345 Predicted transcriptional regulator  ali follow..  16  16.................DTRRKILLILLERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAA.......................................... 63
6 -17.400[K] COG4742 Predicted transcriptional regulator  ali follow..  14  1.....MQSELIDVVFRSQKRRDLLLLLG-EEPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGSYELTDMGEQVFKKARA....................... 78
7 -16.400[J] COG2238 Ribosomal protein S19E (S16A)  ali follow..  21  53..................RCASILRKIYIYGPVGVSRLRTAYG-SGNIIRKALQELEKLGLVEKTPEGRVVTPKGRSFLDNIAKEVRDEIINEI............. 142
8 -15.600[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  13  2...........ELSPVFARRLYLALLVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDG...................................... 59
9 -15.000[K] COG1420 Transcriptional regulator of heat shock gene  ali follow..  17  2...............LTERQLLIFRAIIDHQPVGSKNLLKELPYSSATIRNEMGVLEEYGFIEKTHSGRVPSEKGKSDRQMIRSFFSENYYEMEGLIQNSALMLSD. 116
10 -15.000[K] COG3355 Predicted transcriptional regulator  ali follow..  20  14....DIHDFIAFMYGLSKSDVEVLHILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREK......................................... 75
11 -14.900[K] COG1654 Biotin operon repressor  ali follow..  14  1.............MKDTTVPLTLISLLADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGVDVFTVPG....................................... 55
12 -14.500[K] COG1777 Predicted transcriptional regulators  ali follow..  19  1.....MIDDIDNFIAAISTRREIIRMLTQFERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFV....................................... 65
13 -14.200[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  15  1...............MKMKTLFLLIKLAKMGTVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRVELTEKGINLLEKLYEEISTALYSG.............. 88
14 -13.700[K] COG2378 Predicted transcriptional regulator  ali follow..  12  18...........YNMRKASRLFEIIQILRARRPVTAQTIADMLEVTARSVYRDIAALQTMRVPIEGERGV...................................... 76
15 -13.600[J] KOG3411 40S ribosomal protein S19  ali follow..  14  56..................RAAAIARHIYLRKQVGVGRLCKVYG-SGSVQRKVVQSLEKIGVLEKSNGGRRISQQGQRDLDRIAYSLLEEESE............... 144
16 -13.200[K] COG1414 Transcriptional regulator  ali follow..  1MREPTLETDDRYRAPALDKGLDILELLASVDGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDRYSLTLKLFGLAQLHAPVRRLASFATPFMRELADRSKQ. 107
17 -13.000[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  17  186.................ATNQRIISEIQNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDETRSG....................................... 236
18 -12.900[K] COG1522 Transcriptional regulators  ali follow..  13  2...........SKVELDKIDRKILEVLQSNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIR............................................ 53
19 -12.700[K] COG4189 Predicted transcriptional regulator  ali follow..  14  1MAPNFLLVDAEKEFDVLKIRVQILKLLHEANGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLR............................................ 68
20 -12.600[K] COG3432 Predicted transcriptional regulator  ali follow..  17  42.....................DILRNC--EPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDEITEKGKLLRTHIEE-FIKIRENLYSAKEKVSELLR.. 126
21 -12.600[J] COG4901 Ribosomal protein S25  ali follow..  14  52.....................AIAKEVQNMRVITPYEIASKYGIKMSVAFKVLRNLKERGDLVLVAKG....................................... 98
22 -12.400[K] COG1497 Predicted transcriptional regulator  ali follow..  10  2........KALRKKGELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVES........................................... 57
23 -12.200[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  12  8........NILRSLNRSELRRKVLFYLLSIYPSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKFKINPEIVEEVRNMKNMFSD................... 104
24 -12.200[K] COG1846 Transcriptional regulators  ali follow..  14  40...............LTPSEIHTIDAIGTDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAH-VVLTDKGREAYRAHADMHAAFYEEL.............. 124
25 -11.700[S] COG4754 Uncharacterized conserved protein  ali follow..  14  11................IADLVGLLYVMNNDGKTDLYQLEKEMEVDIDDLMPIVYTASRLGFVSAESGDIIVTEEGKEYIRASIKRRKEIIREALRNIEPFRTALD.. 101
26 -11.700[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  11  1MKQEEMLKKLEDLLKAINEIRIYRLLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRESGWLGYIYTPVSPLEILQKIKEHLMKSIEELERDLKNQ.... 110
27 -11.600[S] COG2469 Uncharacterized conserved protein  ali follow..  188......IEKSKPKEKLSEVEEQILTMVYTG--VDSVSVESILGVTTEELNKMYDRLVNLGLARVVKKEIELTPRGVALVSEIMKKAAR................... 269
28 -11.600[K] COG0640 Predicted transcriptional regulators  ali follow..  17  1..................................MNEITMQTQADQPKVSSNLAILSEARLVDSIQMG....................................... 34
29 -11.400[K] COG1802 Transcriptional regulators  ali follow..  17  11.......ETLRYQVENVLRQAIMSGRFTPGERLIERELCETLGVSRTSIREALRRLEAEKLVSIVHKGPIVAIISRQEAAEL......................... 86
30 -11.300[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  23  22.................GEVGLILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLAD............................................ 67
31 -11.200[K] COG3711 Transcriptional antiterminator  ali follow..  1...............MNGDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINL-PKLERTSQGNFIVSSEIM.............................. 68
32 -10.900[J] KOG1767 40S ribosomal protein S25  ali follow..  17  50.....................KLLTEAPKFKLITPSILSDRMRINGSLARRAIRELMAKGVIRMVAAH....................................... 96
33 -10.900[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  20  246...............LSPELCEVLDIIRGHGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLRNG....................................... 299
34 -10.900[K] COG5340 Predicted transcriptional regulator  ali follow..  15  1MSSTQETQTIRQGLS--TRESRLLSHLAAEGHISIDDVEATLEVAPNTAREIASRLTEKGWLDRLLPGRYL.................................... 71
35 -10.900[K] COG4738 Predicted transcriptional regulator  ali follow..  11  27........ELLRRLNINRPVALTLACLSKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNLTVQMETIIDTIEENVIAESKTILQNIERLKSL.... 132
36 -10.800[K] COG2188 Transcriptional regulators  ali follow..  12  16...................KDYILANIGTGR--SENELVASLGVSRMTVHRALRELTAAGFLIRLQGGTFIAPP................................. 77
37 -10.800[K] COG2186 Transcriptional regulators  ali follow..  12  40...................................RELAQKLGVSRPSLREALIALEIDNTVEIRMGGVYVSTEALQTTHHTGDSPSELMQARAALEGATIVLAANR 115
38 -10.600[K] COG1725 Predicted transcriptional regulators  ali follow..  14  36.................................SVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGGSFVTSDKALFDQLKKELADAITERFLEEAKSI....... 103
39 -10.600[K] COG3888 Predicted transcriptional regulator  ali follow..  17  1................MSLRDVLLRELKRARGIDQFQIEEMMGFSKSTVSEALKDLEEKGIIKRRTIGGKIK................................... 58
40 -10.400[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  15  85...................EILILHSIHRDREKKLADICLALDIEDHIATYAIRKLEKAGLLTTTAKGAEACAHYAQIRERLLVDSTANARPSEETLSELAALLR.. 183
41 -10.200[K] KOG2593 Transcription initiation factor IIE, alpha subunit  ali follow..  23  30.................GIAVLVLDALTRRQWVREEDLAKELKLNTKQLRTILRYFEEQQFIM............................................ 75
42 -10.100[K] COG3682 Predicted transcriptional regulator  ali follow..  20  1.............MHITAAEAHVMEALWRRSPLSADELVAEVSWGEATVKTLINRLLKKKAIKSERAE....................................... 59
43 -10.000[S] COG1693 Uncharacterized protein conserved in archaea  ali follow..  14  1.....MVFLMADETN--QKMMEILRILAEHDVLGAKIIASELNLGERAVRYHMRILDEKGFTERGYAGRRITEKGLQEINR.......................... 81
44 -9.840[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  12  145.................PKRAQVVCVLLDAPQLPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRRLVR.................................. 203
45 -9.760[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  12  2............VLMHTDRIEEYLETIKNQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKYQGVELTEKGAEEAVRIKRK...................... 80
46 -9.640[T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  ali follow..  16  155IGRRTAIERAAYLIAFLYRKAKAANLLPGE-PVTQQHVADTLGLSIVHTNKTLRKLVDRGLIRWIDKGCLVLD.................................. 229
47 -9.560[K] COG1959 Predicted transcriptional regulator  ali follow..  13  12..................RALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYVTAVRGGIRLGKPASAI............................. 74
48 -9.360[K] COG1695 Predicted transcriptional regulators  ali follow..  18  5...................AIKALVLLSKKPRTLSKEISTGVQVSHGTLMPMIRKLLQERYIDFETRGRHLTERGSRFVESLGKIEEDVKQNLIS............ 87
49 -9.340[K] COG3327 Phenylacetic acid-responsive transcriptional repressor  ali follow..  17  1MSKLDTFIQHAVNAVPVSGTSLISSLYHRGGEIWLGSLAAGLGFGERFVRTALFRLNKEGWLDVSRIGRRLSDKGLRLTRRAESKI..................... 98
50 -9.330[K] COG1510 Predicted transcriptional regulators  ali follow..  20  35.....................RVLGII-NRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKV.......................................... 79
51 -9.290[S] COG3177 Uncharacterized conserved protein  ali follow..  11  288.....AIQYSQKRQFINEDEAKILRFAVEQREFKAGDLAKLFSMNANQRTYQIKKLVESGFISPLEEN....................................... 351
52 -9.200[S] COG2411 Uncharacterized conserved protein  ali follow..  10  138......................FLSYGSIRKAARKLGGARKRGEIRKVLRKCYNELVKRGLI............................................. 177
53 -9.020[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  19  24.................EVKRKLLLDLS-TGWITLPVIEQKYG---KEGRRALLYLDKIKMIE............................................ 65

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.