current user: public

If you have questions about the server, please let us know.

Query: [KT] COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440
# Score Template Links and tools%idFirst MATANIAIKQNSSTNIAFIERMPSPSLHRILYNLFSKFSYSLSNSCHFNLKCLNFVMNRMFHMSMEDLSQCTILIVDDSPDNIAFMSQGLAQYYRIKAARSGKVALEILAQYPIDLVLLDIVMPEMSGYEVINQIKHNPHTEHIPVIFLTGKSNPEDEQLGFELGAVDYVFKPVSIPLLKSRVHTHLQNKRSKDILLNQNDYLETEVLRRSGELDRMQDAVVFALASLAETRDPETGNHLLRTQHYVKVLAQRLATTDKYRDVLSPTVIDTYFKAAPLHDIGKVGIPDNILLKPGKLTPDEFTTMRNHALLGKLALEKAEKLSGACTALINVAKEIAMGHHEKWDGSGYPLGLKGDDIPLSARLMALADVYDALICRRVYKEPMSHEEAKAIILQGRGSHFDPMVIDAFLIEEQNFIDIAQKFADEESAMVPIQLGQQASGLast
1 -123.000[KT] COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain  ali  100  1MATANIAIKQNSSTNIAFIERMPSPSLHRILYNLFSKFSYSLSNSCHFNLKCLNFVMNRMFHMSMEDLSQCTILIVDDSPDNIAFMSQGLAQYYRIKAARSGKVALEILAQYPIDLVLLDIVMPEMSGYEVINQIKHNPHTEHIPVIFLTGKSNPEDEQLGFELGAVDYVFKPVSIPLLKSRVHTHLQNKRSKDILLNQNDYLETEVLRRSGELDRMQDAVVFALASLAETRDPETGNHLLRTQHYVKVLAQRLATTDKYRDVLSPTVIDTYFKAAPLHDIGKVGIPDNILLKPGKLTPDEFTTMRNHALLGKLALEKAEKLSGACTALINVAKEIAMGHHEKWDGSGYPLGLKGDDIPLSARLMALADVYDALICRRVYKEPMSHEEAKAIILQGRGSHFDPMVIDAFLIEEQNFIDIAQKFADEESAMVPIQLGQQASG 441
2 -47.200[T] COG2206 HD-GYP domain  ali follow..  19  20................................................................KRYRSMSQKIDVSELQEGMCFSEPVFFDDGENLLLREGTRELTVLQDWNIPYVVTAGRV--LAEGESVPSSTVEELAEFEELAAEELLDPEDDIVSTGELRTQDILKDICELLPKVCINPHYHEEYVGFIQELNMARPADMLAKRLSELVRANTLGFV-SLVLSYKIEGFRFAKPAVDTAIFSIIVAQHLG--------FSEKDIFDLVVASLLHDIGMQHVPADILKKSGRLHFQEQQAVDAHTIYAHSYIVN-------TLKYPNSVGLSVLQHHEHWNGKGYPQSLSGNKITIGARILAVTDNFAAMLAPKSYRKPFSGYQAMKSLLADNARRFDPDVIKAMIQSVGIY......................... 369
3 -31.800[TK] COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain  ali follow..  21  2.....................................................................SYHVLVVEDDLVTRSKLSGYFQEGYQVTEAESGAQMREALELNDIDLVLLDINLPGEDGLLLTRELRSQ---SEIGIILVTGRTDSIDKIVGLEMGADDYVTKPVDLRELQVRVKNLLWRISLAQR----------------------------------ERITDKHDDKLVHFGEWTFDVQRRALSRNGEPVKLTKAEYELL--VALSSYPNQVLSRERIL---NMISHRVDAPNDRTIDVLIRRMRAKMEMDPKNPQIFVTVH-----------GEGY............................................................................................ 229
4 -30.700[TK] COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain  ali follow..  16  1.......................................................MEDLKQEDTEAIGNDPTLLLVDDDKPFLQRLARAMERGFQVTTAESVEEGIAAVKTSAPAYAVVDMRLGDGNGLNIIEAIRSRR--ADTRAIVLTGYGNIATAVNAVKLGAIDYLSKPADADEVFAALTRRPGEKVAPPENPMSADRVRWE-----------------HIQRVYEMCERNVSETARRLNMHRRTLQRILAKRAP...................................................................................................................................................................................... 186
5 -29.700[KT] COG4565 Response regulator of citrate/malate metabolism  ali follow..  20  2...................................................................MELIDVLIVEDETSIADVHSFYLKQ---VGVAQSINEARNMVRILKPKLIFLDNYLPDGRGIEFLKELTHQP--QAPDVIFITAASDMETVREAVRCGVFDYLLKPIAYDRVQNSLERYLKYISSLRANDSVNQRHVDELFNFQAKPKGIDELTLIKIQEIYEPQAAYTAELLGQAIGISKTTARRY........................................................................................................................................................................................... 198
6 -27.200[T] COG4566 Response regulator  ali follow..  18  17...............................................................RKKSSAESIVVVVDDDAAVREGLSELILSGFQPVSFASTQELLNAVDIDGPGCLILDVHMPGESGLDLQHHLAERGI--GKPIIFLTGRGDIPMTVQAMKDGAVDFLTKPVSDRTLLDAVIAAIALDQTQRAEAIVVKRNVERLKTLTR-------------------REREVLREVVTRGRLNKQIAFDLG--------ISEVTVK-LHRANVMRKMEVRSIGELI....................................................................................................................................................... 215
7 -25.900[T] COG3706 Response regulator containing a CheY-like receiver domain and a GGDEF domain  ali follow..  16  135..................................................................TNKRFSVLVVDDARTARSGLVEILERNFKVSEAHSGNRALEILSQDSIQLVITDYHMPDMDGYELTRRIRDSRSSEDLRVIGISSSTDRLLSASFLKAGASDFVYRPFVPEELQCRIDNNIETLKQLKRLRELARSFFERTRALMDVINDNDESGAVAILDIDHFKKNDTLGHDA-LKKLAELLQGMCDEQRHI--------------------PARLGGEEFAVFLRGLDARAAYAFCEE-----REQVEKNGRQLSGSSLALTISLGVVEIEKGE-----------------FDNQLNAADLYLAKANGR............................................................... 425
8 -25.000[T] COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases  ali follow..  11  1...........................................................IEGPSTQCLAGKRLAYVEPNSAAAQCTLDILSEPLEVVYS----PTFSALPPAHYDMMLLGIAVTFREPLTMQERLAKAVSMTDFLMLALPC-HAQVNAEKLKQDGIGACLLKPLTPTRLLPALTEFCH............................................................................................................................................................................................................................................................. 126
9 -25.000[T] COG3707 Response regulator with putative antiterminator output domain  ali follow..  13  11..................................................................TLRDLTILVIDENAIRASIIEEGLREGYQRVVIHEVNGVARTIETLQPDVIFIDLENPNRDMMEHLFQLTRT---VGRPIAMFVDRSDTASIEAAVEAGVSAYVVDGLKKERVKPILDMAVSRFNAFSRLQRELADAKSALEERMKMRGLSEEEAFALLRQTAMNEKKKISEIAQSVVTAAGLL............................................................................................................................................................................................... 203
10 -24.600[TK] COG2197 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain  ali follow..  18  3.......................................................................KILIADDHPLFREAIHNVIADGFPVMETADLDSALGLTQEDDLDLILLDLNMPGMHGLNGLMNLRNE--APTIPVVIVSAEQDKQVVLQAITYGAVGFITKSSPRAQMTEAIEQILNIRTQKSSPRRSGHEEHGISPELLQALTRKQLLVLERMTKGESNKQIAYNLDIAEVKAHVSAILRKLKVHNRVQAILSAGDIDFA......................................................................................................................................................................... 216
11 -24.000[T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains  ali follow..  17  1................................................................MISRKPAHLLLVDDDPGLLKLLGMRLTEGYSVVTAESGQEGLRVLHREKVDLVISDLRMDEMDGMQLFTEIQKVQ--PGMPVIILTAHGSIPDAVAATQKGVFSFLTKPIDRDALYKAIDEALEQSAPATDDSWRNAIVTR--SPLMLRLLEQARMVAQSDVSVLINGQSGTGKEI-----FAQAIHNASPRSNKPFVAINCGALPEQLLESELFGHARGAFTGAVSNREGLFQAAE----------GTLFLDEI-----GDMPAPLQVKLLRVLQERKVRPLG-----SNRDIDIDVRIISATDLPKAMARGEFREDLYYRLNVVSLKIPALAERTEPLLANHLLR.............................. 324
12 -24.000[T] COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain  ali follow..  18  3.......................................................................NVLIVDDEQIEREGLKLFLKDRPNVGEASNGRQAIEKALETQPDLMMMDIKMPGVDGVQAVKEIKQQ--LPETEFIMVSAFDTFEYAREVMRYGVKEYLLKPTTKEDVLTALDRIVGEIEQAREEKNDQYKLQQRLEQISSFVQTESILYL........................................................................................................................................................................................................................... 154
13 -23.200[KT] COG3279 Response regulator of the LytR/AlgR family  ali follow..  19  3.......................................................................RVIIVDDEQPAREDLRERLNEEHGIEECSNALEAIPAIQRLQPDVVFLDIQMPRINGLELASMLNPESMPH---IVFVTAYD--EYAIRAFEEHAFDYLLKPLDHQRLAKTLTRLSRDLIVKNNLHKVIKPILRHIPSGHNRIFLLKIEEVEYLSSELSGVHVVGTVQSGYTQLSLKTLEEKTPFIRCHRQYM................................................................................................................................................................................. 194
14 -20.100[NT] COG2201 Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain  ali follow..  18  1...................................................................MSKIRVLSVDDSALMRQIMTEIINSHSDMETAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFLEKLMRL---RPMPVVMVSSGKGSEVTLRALELGAIDFVTKPQLSEMIAEKVRTAARARIAAHKPMAAPTTLKAGPLLSSEKLIAIGAST-EAIRHVLQPLPLSS-QHM---PGFTRSFAERLNKLCQISVKEAED--------------GERVLPGHAYIAPGKIHDGDVLFHSVAKHAGRNAVGVILTGMGNDGA-MYQAGAWTIAQNEA----GMPRGGVSEVVDLSQVSQQMLAKISAGQAIRI.............................................................. 349
15 -16.600[T] COG0784 FOG: CheY-like receiver  ali follow..  17  2..................................................................TERRLRVLVVEDESMIAMLIEDTLCE---AATASRMQEALDIARKGQFDIAIIDVNLDGEPSYPVADILAE----RNVPFIFATGYGSKGLDT---RYSNIPLLTKPFLDSELEAVLVQISK............................................................................................................................................................................................................................................................. 118
16 -15.300[KT] COG4650 Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain  ali follow..  41...................................................................IDRLELLHDARSRSLFETLKRDIASSPETEVVSVEIELHNPWEVYACLHDFARGYEFQPEKEDYLIHITTG--THVAQICWFLLAEARYLPARLIQSSPPRKKEQPRGPGEVTIIDLDLSRYNAIASRFAEERQQTLDFLKSGIATRNPHFNRMIEQIEKVAIKSRGPTGAGKSFLARRILELKQARHQFSGAFVEVNCATLRGDTAMSTLFGHVKGAFTGARESREGLLRSAN----------GMLFLDEIGELADEQAMLLKAIEE------KTFYPFG-----SDRQVSSDFQLIAGTV-LRQLVAEGKFREDLYARINLWTFT--RQRQEDEPNLDYEVE.............................. 377
17 -15.000[L] COG2254 Predicted HD superfamily hydrolase, possibly a nuclease  ali follow..  18  1.............................................................................................................................................................................................................................MSVCTFFENKVCVET-DHIRKGLEIIEGLYLRRGYGHFLSKILNKLAEELLKKAYIFHDIGKCL-------------QQRREKFRFHEVYSALVAREVFKKYGDIGGVVSVA---ILLHHHNWIREKSPKRPRNLKL-SILLPLVVADNYAAAVNRGGKKSALG--KEIFEVLKVRGWKVASSFSSRF................................ 220
18 -14.800[T] COG1639 Predicted signal transduction protein  ali follow..  12  97.....................................................................REKGLDIFDPQDYKRGMKSFKEENINHYLKLQQQEGLYVKVTMQVLEVINNCKMTPMEFKRVFDKRVRARRYSGLEEALAHILDNSEGAGLGLVI-EEDVYRLVVEEDRTISRMVVPRNIEIQTQTTKLAASIADRSKLLEIQRAIENPDVQLSDIVALISQDVALVTDQAYRTGYFALGLAKATG---------DQALIADSYICGLLHNLGEVKLTEIQAERNIPPHVLDTIMS-GHAEIGAALAQR---------NLPEPVINTIRFHHN-------LPHAPEEYKPLIS-TVAFANMTEQIPRSLLSFFRIQSEQQLRTTAQTLQSSFE....................................... 508
19 -14.500[T] COG3947 Response regulator containing CheY-like receiver and SARP domains  ali follow..  15  1............................................................................................................MIQHKPDLIFLDINLPDINGIDFAEQVQS--ILPEVHIVFITAYD--EYAVKAFELNAIDYVMKPVQRDRLNRTINRITDRKTVEPLRSQTDSAEPIDVNWRTAKARELFAYLVQHRKQPVRKDESDVKKGYAQLYSAIYQIRKMLDSLQMNSTVVSFDKSYKLHLNGTKLDVEEW---ERELRQLPNITEDTLPSYRR-ETYKGDYLAEENERERLRTLYHSTFNKVTTYYLEC--------GYYTDAITLCQRVQTLHPLMETSYFLQVYAKMGDNHSVKHVLEAEYGIHTSDSIENWYNEWKKQ.......................... 335
20 -13.900[T] COG2198 FOG: HPt domain  ali follow..  14  2..............................................................................SNEVRAIVLRQLEN-----WGATCITPDERQISQEYDLFLTD-NPSNLTA----------------SGLLLSDDESGVRKIGPGQLRVNFNMSNAMQ-EAVLQLIEEQLAQEEIPASPLGGDENAELHASGYYALFVDTVPDDVKRLYTEAATSDFAA---LAQTAHRLKGVFAMLNLVP-------KQLCETLEHLIREKDAPGI............................................................................................................................................................. 175
21 -12.800[R] COG3481 Predicted HD-superfamily hydrolase  ali follow..  14  5...........................................................................IMLHEVGEQVDQYLLIKSSTKGIASNGKPFL--------TLMLQD-QSGDIEAKLWDAKQSDEVTYAPQTIVKVVGDVHHYRGRTQLKLRNIRPVSEQENVNIDDFLETAPIPKNEMMDTITQYIFEMKNPIQRITRFLVKKHEAEFMDYPAATKNHHEFVSGHVVSMLNLAKAIADL----------YPSLDRDLLYAGVILHDLGKV------LSGPVSTSYTVEGNLLGHISIMVTELSKAAEELQIDSEEVLILQHLILSHHAEWGSPKPPM--------KEAEILHYIDNLDAKMNM................................................................ 282
22 -12.500[H] COG1713 Predicted HD superfamily hydrolase involved in NAD metabolism  ali follow..  14  5......................................................................................................................................................................................................................DYINCSREALLEKMAELLPEKRLTHCLGVERAAMELAQRFGVD-----------VEKASLAGLLHDYAKKLSDQEFLVLIDRPDLKNWGNNVWHGMVGIYKIQEDLDL--HDSEILR-----AIEIHT----VGAG------QMTDLDKVIYVADYFPGVDVAREIASLSLNKAVAYETARHQGFPIYPQTLETYNAFVHYLKE....................... 196
23 -10.500[S] COG3294 Uncharacterized conserved protein  ali follow..  13  1...................................................................................................................................................................................................MQTLTYEVGVKLIEKVLPDSEKVKKVWELLTSDTEVQADHGPVHSRIVAGSALAIYKILTEKGFKPSVVAEDSIIVTLMGAYLHDIGNS-----------HRTHHPIYSAVLTDRIAEKILSKIYGSTEKMYMLKQEIMHAVFCHDEA------------NCLTFEAACAKIADGTDM.................................................................... 179
24 -9.770[R] COG1418 Predicted HD superfamily hydrolase  ali follow..  11  200............................................................................RTVKTAKDLLAQAMQRLAGEYVTEQTITSVHLPDDNMKGRII------GREG----RNIRTLESLTGIDVII-------DDTPEVVILSGFDPIRREIARMTLESLIADRIHPARIEELVEKNRLEMDNRIREYGEALHPDLIKIMGRLQFRTSFGQN-VLRHSVEVGKLAGILAGELGENV-----------ALARRAGFLHDMGKA----------------DREVEGSHVEIGMEFARKYKE---------PVVVNTIASHHGD--SSARP-GARNES--MENYIKRLRDLEEIATSFDGVQNSFALQAGREIRIMVQPEKISDDQVVILSHKVREKIENNLDYPGN............... 519
25 -9.130[R] COG4341 Predicted HD phosphohydrolase  ali follow..  14  1..................................................................................................................................................................................................................MSGQDLNADNIVEFIADIFERRGAES-EHMLQGAWLAEQDGAP----------------EALVAAALLHDIGH-------YTSEFGTYSPDDVEDKHHDEAGGEVLAPF---------FPPVIVECVRLHVAA---PTYFSRLSPASVPFHEEAVRVR-IWDEGGKVANMKTR-AFRDYVPLLQR.............................................. 185

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.