current user: public

If you have questions about the server, please let us know.

Query: [D] COG3640 CO dehydrogenase maturation factor, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MEGFGMPKLIISGRGGSGKSTLVTLIAHTLKEQKKRVLVVDSDESNIGLSGILGIEPAEKTLMDYLGGKPRVMKKLRSMIRDGETEPELFREKFDLESLSQEFVCWVGSLGLMQIGKIDHAMEGCACPMGAVTRDFLNHVRLEEDQWVLVDTEAGVEHFGRGIVEGADAVVMVVDPSSDAVLLAEKAAKLTHEADKRFGVILNKIDEETEPILTELLTSEGNEIKGVLPYSPAITKMNLKGESLGAYAVKNEVDEIIRELMKCLast
1 -81.400[D] COG3640 CO dehydrogenase maturation factor  ali  100  1MEGFGMPKLIISGRGGSGKSTLVTLIAHTLKEQKKRVLVVDSDESNIGLSGILGIEPAEKTLMDYLGGKPRVMKKLRSMIRDGETEPELFREKFDLESLSQEFVCWVGSLGLMQIGKIDHAMEGCACPMGAVTRDFLNHVRLEEDQWVLVDTEAGVEHFGRGIVEGADAVVMVVDPSSDAVLLAEKAAKLTHEADKRFGVILNKIDEETEPILTELLTSEGNEIKGVLPYSPAITKMNLKGESLGAYAVKNEVDEIIRELMKC 263
2 -48.400[D] COG0455 ATPases involved in chromosome partitioning  ali follow..  20  37.PSVTKVISVTGGKGGVGKSNVTLGMAICMAKQGKKVMVLDADLGLANVDVMLGIRP-KRNLGHVLAGECELKDAIVEG--------------------PHGIRIIPATSGTQSMTELSHA------QHVGLIRAF--GTLEDEMDILLIDTAAGISDMVVSFSRAAQDVVVVVCDEPTSITDAYALIKLLSKEHQRFKIVANMVRSYREGLVTERFLNVSLELVACIPLDDNVRQAVKRQKIVVDAYPRSPAALAISSLAN. 278
3 -48.400[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  17  2.....KQVAVISGKGGTGKTTFSATIHALEG-----GVVADCDVDAPNLHILLKPQILKAEDFIASKKARIMPEKCSSCGLCYDLCR--ERAIEMENVKTGDLYVSKTEWGYFVHARLKPGEENTGRLVTEVKNRAKEIAEESNAEFLIVDSAPGVGCPVMASLTGVDAAIIVTEPTVSGLSDMLRILELCEHFRIRPFVVVNKFDVNIASEIESYCSENGVEFAGRVPFDKAIPEQIANLNFPFSGKAADKMVEIWKKLRE. 281
4 -47.300[D] COG2894 Septum formation inhibitor-activating ATPase  ali follow..  15  1...MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVYDFVNVIQGDATLNQALIKDKRTEN-------------------LYILPASQTRDKDALTREG----------VAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFADEAIITTNPEVSSVRDSDRILGILASKSRREHLLLTRYNPGRVSRMEDVLEILRIKLVGVIPEDQSVLRASNQGEPVI-LDINADAGKAYADTVE. 244
5 -42.100[D] KOG3022 Predicted ATPase, nucleotide-binding  ali follow..  19  55MSTVKHKILVLSGKGGVGKSTFSAQLSFALAGMDHQVGLMDIDICGPSIPKMLGLEGQEIHQSN---------------------------------------VYVEDNLGVMSIGNSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPPGTSDEHISIVQYLDGAIIVTTPQEVSLIDVRKEVSFCKKVGVPVGVVENMSLTAAEAVQKECVGKWEYRFLGKFLWIHNFAKQLNKVSHALRITS.............. 294
6 -38.900[P] COG1348 Nitrogenase subunit NifH (ATPase)  ali follow..  19  1.....MRQVAIYGKGGIGKSTTTQNLTSGLAELGKKIMVVGCDPKADSTRLLLGGLAQKTVLDTL------------------REEGEDVDLDTIMKTGFGNIKCVESGGPEPGVGCAGRGIIT----SINMLEQL--GAYEDELDYVFYDVLGDVVCGGFAMEGKAKEIYIVASGEMMAMYAANNISKGISKFANTGGIICNSRKVKNEKELLEAFAKLGTQLIYFVPRSHEVQKAEINKQTVIQFNPKDEQADEYRALAK. 242
7 -37.400[U] COG4963 Flp pilus assembly protein, ATPase CpaE  ali follow..  14  7.EPLGRNIAFIGAKGGVGSSTIAHNCAFGISSLSTETILADMDLAYGTANIDFDQDP-AQGMAEAVFSPERLDEVFLDRL---------------LTKCSDHLSLLAAPSLLDRTYDLDRQA----------FLPILEVLQ-RSAPVAVLDLPHQWCDWTRAVLAEADEVVITAVPDLANLRNTKNLFDALIKLRPLPHLVLNQVGMPKRPEIADFLEPLEIEPIAIIPFDQLFGNAANSGRMISEMDEKSQTAETFSQIAHT 248
8 -29.400[D] COG1192 ATPases involved in chromosome partitioning  ali follow..  14  1...MAKIISTVNMKGGVGKTTLTVNLATCLAKYQKRVLVLDLDS-QISATLSLMAPHDFAAIRKKGKTLSYLLANAIQPNPYSKL--DIFDIICPEICQIEGLELIPGDIELYDEYLVSEKLHQAAIATENLIKEMLAPVL-EEYDFVILDCAPGYNLLTRSGIAASDFYLLPARPEPLSVVGMQLLERRIEKLKESIGVVFILSGGGLMSRYYNQVMRRVQTDFTSIPMDVNVAKAVDSFMPVVTSMPNTAGSKAFIKLTQ. 288
9 -25.000[D] COG0489 ATPases involved in chromosome partitioning  ali follow..  19  86QERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADIRNPGLSRMLTTRQSA--LVEVVLDEVPWTQAVKVDTRT--------------------------KMGILPVSTSNQFAHSSELLSSSGMRKFIDSAR-EACDYIIVDLAP-----AKAFAPQVDGFVFVTEWGKTPIQMVQNLMANEPQIANKTGIVLNKTDMTELQ.................................................... 270
10 -22.300[P] KOG2825 Putative arsenite-translocating ATPase  ali follow..  12  14LEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAH-NLSDAFGTKGKDARKVPGFDNLSAMEIDPNLSIQEMTEQADQQNPNNPLSGMMQDLAFTIPGID-----------------EALAFAEILKQIKSMEFDCVIFDTAP-MESMRANISEVNKQFVCVCISEFLSLYETERMIQELTSYEIDTNIVVNQLDPNTTCPQCMARRKMQQKYLAQI-------EELYEDFHVVKVPQVPAEVRGTEALKS. 312
11 -19.500[P] COG0003 Oxyanion-translocating ATPase  ali follow..  13  1.....MRVILMTGKGGVGKTSVAAATGLRCAELGHKTLVLSTDPA-HSLADSFDLELGHEPRLNLWGAELDALMELEGNWGAVKRYITQVLQARGLDGVQAEELAILPGMD-----------------EIFGLVRMKRHYDEADYDVLIIDSAP-PYEFYEQIEALEKVLRLVTNPEKMVLKESLRAHAYLSLYNVSTLVIANRI.......................................................... 249
12 -15.100[R] KOG1533 Predicted GTPase  ali follow..  11  36........VLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVN---------------------------------ITEMITVNDVMDRLGLGPNGALKYCIETLGAN-----------CNWLLQKIEANHKKYLIIDCPGQLEGELWKVIRFLEKALHLADSLYCSISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYD................................................ 214
13 -14.700[K] KOG1534 Putative transcription factor FET5  ali follow..  10  6........AFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVD---------------------------------IRDLISIDDVMEELDYGPNGGLIYCFEFLMEN-----------LDWLNEEIGDYDEDYLIFDMPGQIEPILPALIRHLQVAVYLLESQFLVFAGVLSAMSAMVMMEVPHINLLSKMD......................................................... 176
14 -14.500[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  12  3....RPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYTKEDARIL-------------------------------------------------------NTSVLPADRIAGVETGGCPHTASMNFAAIEEMCDKDLQLLFLES-GGDNLSATFSPDLVDFSIYIIDVA-QGEKIPRKGGQGMIKSDL---FIINKVDLAPYVGANVEVMKADTLKSR--GNKDFFVTNLKTDEGL................... 188
15 -13.600[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  17  56.......RLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSP--GSILG------------------------------------------DKTRMNDLARAEAAFIRPVPSSGHLG------ASQRARELMLLCEAAGYDVVIVET-VGVGQSETEVARMVDCFISLQIAGGGDDLQGIKLMEVAD-------IVINKDDGDNHTNVAIARHMY........................................... 217
16 -13.400[H] COG0132 Dethiobiotin synthetase  ali follow..  12  2.....LTRLFVTGTDAVGKTVVSRALLQALSQNGRTAVGYK-PVATESKETSEGLRNQDALILQASSSIELNYQEVNPYPLQGDVIHACTDTLINYEKMTEGL-----------------------------------QCLSAKADTVIVEGCGGWKVMMNDQRFYSD-VILVVGIKLGCINHALLTAQAIINDGLPLGWVANRINPGLAETIAMLRDRLAAPQLGQLPYLPRPEEKPLAK...................... 213
17 -13.400[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  18  44........IIVVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGANID---------------------------------IRDTVKYKEVMKQYNLGPNGGILTSLNLFATK-----------FDEVVSVIEKDQLDYVLVDTPGQIEASGAIITEAFASVTYVVDTPRSSMSNMLYACSILYKTRLPLVLAFNKTD......................................................... 214
18 -12.700[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  29  5.......VLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSDLGFSDADRV.......................................................................................................................................................................................................... 58
19 -12.500[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  15  27ESLRKPAKVMIIGDVDTGKTTLTIYLANELLSRGFRVAIIDSDIGQKGILPTISLAFVDSHFTSLDDLKAFSHYFIGTITPNQYFG-----------------------------------------EMVVGVMKLSELAM-KFSDVVLIDTTGMIYGSGVELKRMKNLILALERNNELA................................................................................... 172
20 -11.800[C] COG3954 Phosphoribulokinase  ali follow..  13  2..SAKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEGD---------------------HRYTRPEMDMAIRKARDAGRHISYFGPEANDFSLLEHTFIEYGQTGKG-QSRKYLHTYDEAVPWNQVPGTFTPWQPLPEPTDVLFYE---GLVTPQHDVARHVDLLVGVVPIV--NLEWIQKLIRDTSERGHSREAVMDSVVRSMDD.................................................... 189
21 -11.500[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  14  108SASSQGPRVIIVGDIDSGKSTLAKMLLNWAVKDGWKPTFVDLNVGQSSITITIAAAPIKMLVDPVEGFPLDKALIHYFGLTNPSVNLRLYRT--------------------------------LVEELARELKEEFSANAESRASGMVIDTMGFIVREGYALLLHASLVIVVGQEEKLV................................................................................... 263
22 -11.500[R] KOG2486 Predicted GTPase  ali follow..  14  130CPADGLPEFALVGRSNVGKSSLLNSLV-----RRKRLALTSKKPGKTQCINHFRINDK--------------------------------------------YLVDLPGYGYASAPHELKQD-------NKFTKDYFLNRSTLVSVFLLVDASIPVKPIDL------------------------EYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEF-FETTPPWIMTSSVTNQGR------DEILLHMAQLRN. 313
23 -11.500[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  13  91....AKPMILLVGQYSTGKTTFIRYL-------------LESDFPGIRI----GPEPTTDRFIAVMHGDEE-------------------------GSIPGNALVVDAKKQFRALSGFGNAFLNRF-QCSTLPNQVLESVT-------IVDTP-GITGVLEWFAERVDRIILLFDAHKLDISEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQ. 314
24 -11.100[N] COG1419 Flagellar GTP-binding protein  ali follow..  17  174.......KVLFVGTTGVGKTTSLAKLAARFKDEKKRVAILTLD------TYRIAAAEQLKIYADIM------------------------------------------DIPMKIAYTPKE------------AEYEMMAL--KDYDIVLVDT-AGRSHQNDLQMSELRALSEAVKPNITFLDDMKRIVERFSAVKPT-HIILTKMDETSVGTFVNISEITGLPI--RVPDDIFEANPVELARIVAGEVLNHARSSGTSE.... 376
25 -11.000[L] KOG2373 Predicted mitochondrial DNA helicase twinkle  ali follow..  13  377.......LTILTGPTGSGKTTFMSEYSLDLAMQGVNTLWGSFEIRNTRLAATLLRQYVGYPLDDRLHEFNHWAAEFER-------------------------------LPLYFMTFHGQQP------LKPVLEAIEHASYVHDVMHVIIDNLQFMMGVSTFRGDKFFEQDSIIA----------AFRSFATKHNVHVTLVMHPRKERQEDELT----------TSSVFGTAKATQEADNVLIIQDKRLTSVRGKKYLQIAK. 574
26 -11.000[U] KOG0781 Signal recognition particle receptor, alpha subunit  ali follow..  18  430.......VVVFVGVNGVGKSTNLAKVAYWLQQHKVSVMMAACDTFRSGAVEQLRTHARRL------------------------------------------------QIPIFEKGYEKDPA--------VVAKEAIQEATRNGSDVVLVDT-AGRMQDNEPLMRALSKLINLNQPDLVAVDQLSKFNQKLSDLSTS-GILLTKFDDDKVGAALSMVYISGSPVVGC-------------GQSYTDLKK--NVKAIVKTLLK. 634
27 -11.000[L] COG3598 RecA-family ATPase  ali follow..  12  362IKGVQGHKMLIAGPSKAGKSFALIELSIALAEEQGKVLYVNLELDRPSALHRF-------------------------------------------KDVYDAMGLPPANVANIDIWNLRGKTV----PMDKLAPKLIRRSLKKNYQAVIIDPIYKVLTGDENSADQMAHFT-------------NQFDKVATELGCSVIYCHHHSKGSQGGKKSMDRASGSGVFARDPDALIDLVELELTEDLIKARSEKAAAKIYQQAL... 572
28 -10.900[H] COG1492 Cobyric acid synthase  ali follow..  14  1.....MKGIMVQGTADVGKSLICTALCRIFARRGYKVTPFK--------SQNMSNNSYITVEGLEIGRAQGIQAEAAMEEASVYMNPILLK-----PRNDREAEIVCFGQAVDTVSGVKYRDGFYKRGLEAIKQAL--ATLSQSFDMVVIEGAGSPELVNMKVAELADVVILVADIERGGVFASLYGTLELLQPNERKGIIVNKFRGDPSSGVQWIEQHLGVPVLGVLPHLPGVRIEGEDSLSKGQVTSVLPRDQSIDIAV.. 257
29 -10.700[H] COG1797 Cobyrinic acid a,c-diamide synthase  ali follow..  16  1...MQPRLVIAGTHSGVGKTTVTLGLMAAFVEKGNIVQGFKCDYIDPSYHRAV-TKRASRNLDSWMVSEDVVNDIFIEGCNGA--------------------------------------------------------------DLSIIEGVMGFKGSTADISLLLQAVLLVVDISGMARSAAAVVKGFQQNEKVKIGVILNGAGSERHAEMCSEAIKCGIPALGYLKKGDVP-SIPERHLGLVPALERGEHDSLFSQLAAV 212
30 -10.600[U] KOG0780 Signal recognition particle, subunit Srp54  ali follow..  15  96PKKAKPSVVMFVGLQGAGKTTTCTKYAYYHQKKGYKAALVCADTFRAG--------------------------------------------------AFDQLKQNATKAKIPFYGSYTESDP------VKIAVEGVDRFKKEKCDLIIVDT-SGRHKQAASLFEEMRQVAEATEPDLVIFQAAFEQAEAFKETVSVGAVIITKMDGHAKGGGAVAATKSPVIFIGT.................................... 275
31 -10.400[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  16  110LLQQKGCVVWITGLSGSGKSTVACALSKALFERGKLTYTLDGDNVRHGLNRDLTFKAEHRT-----ENIRRIGEVAKLFADVGVICIASLISPYRRDRDACRSLLPDGDF------------------VEVFMDVPLHVCESRDPKGLYKLARAGKIKGFTGIDDPYE------APVNCEVVLKHTGDDESCSPRQMAENIISYLQNKG...................................................... 289
32 -10.400[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  22  1...MLLPNILLTGTPGVGKTTLGKELASKSGLK-----YINVG............................................................................................................................................................................................................................ 35
33 -10.400[S] COG3367 Uncharacterized conserved protein  ali follow..  12  152IYRKKIKVVGVFGTDVVGKRTTAVQLWERALEKGIKAGFL----ATGQTGILIGADAGYVIDAVPAD------------------------------------------------------------FVSGVVEKAVLKLEKTGKEIVFVEGQGALRHPAYGQVTNPDVVFLVHDPSRDHFESFPEIPKK-PDFEEERRLIETLSNAKVIGGVS-------------------LNGGFETDLPVYDPFNTDDLDEMLERAMV. 337
34 -10.400[R] KOG2878 Predicted kinase  ali follow..  33  21.PEGRPFILGISGPQGSGKSTLASALDTELTRKNESVVKFSLD............................................................................................................................................................................................................................ 62
35 -10.300[G] KOG3354 Gluconate kinase  ali follow..  13  15......YVFVVIGPAGSGKTTMAKAVSEKLEKMSQGHPLNDND--GGACAMELDKESIKGVVLTCSALKRSYRDILRSSLEHRPAILRFIYLAASRETLIKRTTSRKNHYMKADMVESQ---------------AILEAPTADEKDVITISVENGKEQSEEECLDIVHKMV............................................................................................ 187
36 -10.300[R] KOG2750 Uncharacterized conserved protein similar to ATP/GTP-binding protein  ali follow..  13  327.SDYVVPRLMVCGPKGSGKSSFSRYITNRLLQQYRHIAYLDLDPGQPEVVPHISLYYINSPLQGPVFARMLFPTYMLR------------------------------------LGDISPQKD----HYIACVTRLFAEYKDYIFN-LIINCPGWIRGGGAELLSS---IVDICQPT...................................................................................... 474
37 -10.200[U] COG0552 Signal recognition particle GTPase  ali follow..  15  122.......VILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDTFRAGAIEQLEVWGERTGVPVIKQTAGS--------------------------------------------------------DPAAVIYDAVHAAKARNADVLICDT-AGRLQNKVNLMKELEKVVLLALDATTGQNAMAQAKEFSKATNVT-GIALTKLDGTAKGGIVLAIRNELHIPVKLVGLGEKV-------DDLQEFDPESYVYGLFSDLVE. 325
38 -10.100[R] COG2403 Predicted GTPase  ali follow..  10  134..ILEKPSLKILG-KRIGKTAVSAYAARLIHERQYNPCVVAMGRGGPEEPEIVHGDRIEITPEFLMEQSDKGVHAASDHWEDALM------------------------SRILTVGCRRCGGGMVGDVFITNMKRGAETANRLDADFVILE-GSGAAIPPVKS----NRHIVLVGAN-QPLINIKNFFGPFRIGLADLVIVTMCEEPMAGDEKVREIVDF----IESINPEAEVITTVFRPKPLGEIEGKN............ 349
39 -9.940[R] COG0645 Predicted kinase  ali follow..  11  1.....RFLAVTHGVSAVGKSQVAMRLVEALG-----AVRLRSDIERKRL---FGEQPEHDR--------------------------GQFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQ............................................ 180
40 -9.820[U] COG3451 Type IV secretory pathway, VirB4 components  ali follow..  193........MAVCGTSGAGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGLDGETLRFNPF-VHEGLLLQAVRAAWLTKKNRARIDDVVDFLENAREPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLNVID----------------EGWRLLDFKNRKVGDFIEKGYRTARRHTGAYITITQNIVD-----DSDKASSAARAAWGNSSYKIILKQSAKEFAKYNQLYPDQFPQLHREMIEKF 499
41 -9.820[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  10  36......SLTLIEGENDTGKSVLCQQFVYGGLMSGHNIAYYTTENTIKSFMESLSLDVSDFYAWG----------------------------------------------YLRVFPVHLEGIDWSTEQMRSILNLVANHIKTIRENIAIID----------------SLTMFTTYSTEDDVLEFLTRLKNLCDNGKTILITLHQHAFKEDTLVRIRSACDCHLFLRKEQVGDRYVSV.......................... 207
42 -9.790[R] COG3596 Predicted GTPase  ali follow..  13  40.......VIGIMGKTGAGKSSLCNALF------AGEVSPVSDVAACTR-------------------------------------------------------------------------------------DPLRFRLQIGEHFMTIVDL-PGVGELYREQLPRLDLILWLIKADDRALATDEHFYRQVEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKC 215
43 -9.700[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  28  1.....MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISEN............................................................................................................................................................................................................................ 38
44 -9.670[G] COG3265 Gluconate kinase  ali follow..  12  1...MSGKCIIVMGVSGTGKSCVGQALALALG-----AKFIDGD-NIQKMAAGQPLNDQDRALERLSDVAYSLQQKNEVGFLVCSALKKQYRDRLREGNEGIRFLWLTGDYDLVLHRMQQRAGHFMPESLLKSQFATLEAPGSDEPDVIPIDISSSIADVVEHCIAALS............................................................................................... 167
45 -9.610[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  24  1.....MNIFGITGWKNSGKTTLTEKLVAELVRRGWKVSTVKHAHHDFDID..................................................................................................................................................................................................................... 45
46 -9.590[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  11  24......KLILLNGGSSAGKTSLALAFQDLAAE---CWMHIGIDLFWFALP--------------------------PEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLA---------------HSRYRAIRAYLDNGMNVIA------------------DDVIWTREWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDGWNRGSARAAHADAEYDFELDTTATPVHELARELHESYQACPYPMAFNRLRK. 221
47 -9.540[U] COG0541 Signal recognition particle GTPase  ali follow..  21  95LSTQPPAVILMAGLQGAGKTTSVGKLAKFLKERHKKVLVVSADVYRPA--------------------------------------------------AIKQLETLAQAVGADFFPSDVSQNP------VQIAQAALSEAKLKFYDVLIVDT-AGRLHVDGEMMDEIKQIHAALNPIETLFQDAANTAKSFNEALPLTGVVLTKVDGDARGGAARQITGKPIKFLGV.................................... 275
48 -9.530[R] COG4240 Predicted kinase  ali follow..  13  90.......IQGILGSQGTGKTTMSLVIQLILQHLGYRTLSLSLDKTYSDRLVLLQQDPRLIWRGPPGTHDIDLGLNVLEQIRQGKSPVIVPRFDKSAHAGAGD-PDVITGVDILIF---EGWFVGVRPIDPSLFNFPPSPILTDEDKAFARDMNLRLNHY-LPLWEKLDSLILLYPTDYRCSLEWRKQAEQKMIAAGKTGMSNTQIEEFVNYFWRSLHPELFIQPLSQCAALVDLVVEIHPDHTFGQVYQPN............ 334
49 -9.520[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  14  74....RHMKVAFFGRTSSGKSSVINAML------WDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPK--------------------------AKCALLRD----------DLVLVDSP-GTDVWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEWL-NIFILNNRWDASEPEYMEDVRRQHMERCLHFLVEELKVANALEAQNRIFFVSAKEVLSARKQK.... 295
50 -9.500[F] COG1428 Deoxynucleoside kinases  ali follow..  14  1MEGVGNKVIVLAGMIGAGKSSYTELIANELGTK----AFYESIKDNRILEMFLQIYFLNTRFRSIKAALTDQNNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLLDNMMEELAYMPKKAPDLLIYLRGSLDTVLSRISLRGRPYGLLDYYKHLHSRYDSWFESYDKSTLVINIDEVDINKPSDAKYVMQLIHEKL................................................................. 212
51 -9.490[R] COG0857 BioD-like N-terminal domain of phosphotransacetylase  ali follow..  12  1...MSRIIMLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFAPDQTTTIVRANSTLPAAEPLKMSHVESLLSSNQK------------------------------------------------------DVLMEEIIANYNTKDAEVVLVEGLVPTQSLNYEIAKTLNAIVFVMSQGTDTPEQLNERIELTGAKNTNIGVIINKLNAPVDEQGRTRQESSPLPVLGAVPWSFDLIA........................... 228
52 -9.400[R] COG3911 Predicted ATPase  ali follow..  23  1MQNDFDRVFVLTGGPGSGKTT----LIAALRRAGFATS................................................................................................................................................................................................................................. 34
53 -9.300[R] COG3972 Superfamily I DNA and RNA helicases  ali follow..  12  214ALVTIDGPQRIRGLAGSGKTVILAMKAAHLHMTNDKILVT-----TKSLRSPI-------------DLVTKFYRHYKEIDPDWNNIHIRHGWGGSNSSGTYADACRRSGRMPRSYSSARDAAPRGVEPFSFACEELINS-SLEYYDHILIDEGQDFPDGFYKLCFELKKNIVWAYDELQNI.................................................................................. 388
54 -9.280[R] COG1160 Predicted GTPases  ali follow..  15  1...MATPVVALVGRPNVGKSTLFNRLT-HAHIAGYDFIVIDADIVLFLVDARAGLTAADIGIANYLRGVTQLMEQVLAPFAEKMENADENDRTSEEEQDEWE-EEQDKNIKIAIVGRPNVGKSTLTNRILGEDRVVVFDMPGTTRDYTLIDT-AGVRKRGKQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKSELDRR-LDFIDFARVHFISALHGSGV------GNLFDSIKEAYAC 387
55 -9.030[A] COG5623 Pre-mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  14  119.SNFEGPRVVIVGGSQTGKTSLSRTLCYALKFNAYQPLYINLDPQQPIFTVCISATPISDILDAQLPTWGQSLTSGATLLHNKQPMVKN--------------------FGLERINENKDLYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSNLAELHHIIEKNVNIMLVLCSETDPLWEKVKK............................................................................. 293

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.