current user: public

If you have questions about the server, please let us know.

Query: [R] COG3772 Phage-related lysozyme (muraminidase), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGATRGDGKPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFLSVQHWPRLast
1 -81.200[R] COG3772 Phage-related lysozyme (muraminidase)  ali  100  1MNAKIRYGLSAAVLALIGAGASAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGATRGDGKPVIPGMKLSKEKCDRVNAIERDKALAWVEKNIRVPLTEPQKAGIASFLSVQHWPR 116
2 -6.860[R] COG3926 Putative secretion activating protein  ali follow..  13  2...................AVSRERESLARVLAHEGGYSNHPNDPGG--PTMKGVTQRVYDGFRKGKGLATRSVKSITTAELNEIYDR--DALPAGVDYVVFDG-----AVNSGPG 97
3 -6.020[R] KOG4373 Predicted 3`-5` exonuclease  ali follow..  67..............DYTFVGVWNSQDARKLERSRHQLEIDDLLDLRKYVEDSSGRRSMRGCSF-------EVIVEECLGYRGVRLDREISMS-AYELCDDQQASIDAHVCFKLGVK 165
4 -5.690[L] COG0776 Bacterial nucleoid DNA-binding protein  ali follow..  17  14.......................................................................DKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDK 58
5 -5.360[N] COG5603 Subunit of TRAPP, an ER-Golgi tethering complex  ali follow..  12  72..........GGGFLRSRAVNNTDNCYLGKVDHFYGLAITAYISYSGMKFV-----MIHGNSANSSVVIDDNNMRSFYQEVHELYVKTLMNKITDPIRSPAFDSRVRTLARKHLSK 175
6 -5.200[QI] KOG0157 Cytochrome P450 CYP4/CYP19/CYP26 subfamilies  ali follow..  300ENPQVVTKIRQEINTSNGGQEKPSCEPMEYLNNLEAMRLYPRMSPIKPDVLPSGHKVDSSMKILI-FIYALGRMRAVWGEDASEFKP--ERWLSETTSLRHEPSF-KFLAFNAGPR 424
7 -4.980[S] COG4068 Uncharacterized protein containing a Zn-ribbon  ali follow..  10....................................................HKHCPVCSTPIPMDEVTCSERCQEILSKNQQRVRRTMIFYLVFALFIVVWVVL........... 63
8 -4.870[R] KOG1541 Predicted protein carboxyl methylase  ali follow..  14  27..............RVQHIQAKMTLRALELLNLQPCSF---------ILDIGCGSLTQEGDHVWCGLDISPSMLATGLSRELEGDLMLQDMGTGIPFRAGSFDAAISISAIQ.... 121
9 -4.870[S] COG3184 Uncharacterized protein conserved in bacteria  ali follow..  17  97..................................................................................QAVRNTLLKNAREIYTQEEIDGMIAFYGSPVGQS 130
10 -4.800[P] COG0376 Catalase (peroxidase I)  ali follow..  149IKQKYGQKISWADLFILAGNVALENSGFRTFGFGAGREDVWEPDLDVNWG--EALAKAPLGATEMGLIYVNPEGPDHSGEPLSAAAAIRATFGNMGMNDEETVALIA--GHTLG.. 270

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.