current user: public

If you have questions about the server, please let us know.

Query: [R] COG3911 Predicted ATPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# Score Template Links and tools%idFirst MQNDFDRVFVLTGGPGSGKTTLIAALRRAGFATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLGYLRLSGLPVADHVSTAAKRFRYNPRVFIAPPWPDIFAQDEERKQTPDEAKCTYHALAEIYTELGYELVPLPLAPVETRLRFVLADAGLNLast
1 -84.200[R] COG3911 Predicted ATPase  ali  100  1MQNDFDRVFVLTGGPGSGKTTLIAALRRAGFATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLGYLRLSGLPVADHVSTAAKRFRYNPRVFIAPPWPDIFAQDEERKQTPDEAKCTYHALAEIYTELGYELVPLPLAPVETRLRFVLADAGLN 183
2 -63.000[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  18  3VKPFFVRTVAILGGESSGKSTLVNKLANINTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFA---VKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTP--WVADGLRSGSSVDRKEFQNLLVEMLEENNIEFVRVEEEDYDSRFLRCVELVR.. 180
3 -21.800[F] COG2019 Archaeal adenylate kinase  ali follow..  12  2.......RSVITGVAGVGKTTVLDIVARESGIPVVNYG-TLMFEVAKRRGLVENRDQIRKLSRETQVDLQKLAGEEIGKMENAIVDTHMS-----IKTPFGYLPGLPEWVLRSINASVFVIIEADPAIIKRNDPTRARDDEGVDSIREHQESIFSGATVKIVKNEEGKPEQAADEIVRVIK.. 181
4 -18.400[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  12  19.GMPEGKLILLNGGSSAGKTSLALAFQDLWMHIGIDLFWFALDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRV----------WMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAEYDF-ELDTTATPVHELARELHESYQ.. 208
5 -18.400[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  11  79..DENSKVICVEGPIAAGKSKFAKELAEEDMEYYPAVDLDDVRNFCLDPSHDLAAQFQIRMYMLRYSQYIDALQHVLSTGQGVVLERSPYSDFVFMEAMFRSVYNELRQNTIGEKPHLVIYLDLPVDAVKKQIKARNVDYEVQSDLEQLYKQQYLKDISTHAELLIYDWTAETEVVVEDIE.. 305
6 -17.700[F] COG1428 Deoxynucleoside kinases  ali follow..  1MEGVGNKVIVLAGMIGAGKSSYTELIANEGTKAFYES----IKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLDLLIYLRGSLDTVLSRISLRGRPYEQTKHLHSRYDSWFESYDKSDTLVINID-PSDAKYVMQLIH.. 209
7 -16.400[F] COG0125 Thymidylate kinase  ali follow..  15  6........ITFEGPEGAGKTTVLQEIKNIGGIDIAEQIREVILNE--NNILMDPKTEALLYAAARRQHLVEKVKPALEQGFIVLCDRFIDSPLAYQGYARGLGIDEVLSAIGDMMPHVTVYFSIDPEEGLKRNRLDLEKLDFHTKVQEGYQELMKRFPERFHSVDAGQSKDLVQDVLKVID.. 204
8 -16.200[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  15  2.......LIAITGTPGVGKTTVAKLLAKKLNYEYVSLKDFALEKGCGRRVNDEVEVEIDELAYFI---------ERELKGKNAVLDGHLSHLM---------------------PVDLVVVLRAHPKLIGERDREKIGENVEAELVDAVLIEAIEEHENVIVDTTNKSPEDVVEEIVSLIN.. 152
9 -16.100[G] COG2074 2-phosphoglycerate kinase  ali follow..  86RQCKEPLIILIGGASGVGTSSIAFEVANR-NMISTDMIREVMRKIVSRELLPSVLIGFRDHVESVSIGVEAVIERALTEGISIVIEGVHI------------VPGFIREDLVNKENVAMFVLTVSDENVHKGLKRYISYFWAIRRIHRYIENQARKHGVPV--IENIDVVTTIDSIIKSL... 290
10 -16.000[R] COG4639 Predicted kinase  ali follow..  11  3ITIPELSLVVLIGASGAGKSTFARKHFQPFEVISSDFCRGLVSNDENSQSA----------SRDAFDVLHYITTKRLAAGKLTVIDATNVQP---------EDRKTLLQMAKQYHCFVAIVFDLPEELCHERNQQRSDRQFGSHVVRRHTQML.............................. 137
11 -15.800[F] COG4088 Predicted nucleotide kinase  ali follow..  12  4........IIVSGYPSSGKTTRSNELKKA-NIDNTKDYRVIIINDESLNIEKETYRESKN-EKAARGLLYSAVQRELSKSTFVICDAL---------NYIKGFRYQLYCESKSMYTTHVIHVAVPQDLCRKFNSNKEQPYPDDEQLMFRYENGMTRWDSPLFTVLHDDASCPIDDIWSVL... 176
12 -15.600[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  17  2....LLPNILLTGTPGVGKTTLGKELAS-------KSGLKYIN-----------------VGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKTDNIQCEIFQVLYEEATAVHQLPSNKPEELENNVDQILK.. 161
13 -15.600[F] COG1618 Predicted nucleotide kinase  ali follow..  13  6.KEKTMLRIAVTGSPGVGKSTVVAKTEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTVNLDDLERIGANAVRNALACDLVVIDE-----IGPMELISQSFVSAVEEVLESDKPVLAVL---------------------HHSSRHPLAQRFRK-GFEVLTVDKGNRDELPEKITNRFL.. 180
14 -14.700[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  12  9ADKAKQIVVLLIGPPGSGKSTFCDTAMRSSHRPWSRICQDIVNNGKAGTKAQC----------------LKMATDSLREGKSVFIDRCNLDR---------EQRSEFIKLGGPEFEVHAVVLELPAQVCISRSVKRTGHEGNLNKMLQSKELPKVNEGFS--RIMFCYSDADVDNAVNMYN.. 171
15 -14.200[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  19  4........VVITGLPASGKSTRARQLRDRGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEAS---RHLNQEDLVILDAG---------NYIKGYRYELYCMSKVSRTTQTVFTCIPQEEAWTFNSQRTAPDELP........................................ 131
16 -14.000[R] COG3596 Predicted GTPase  ali follow..  40.......VIGIMGKTGAGKSSLCNALFAGEVSPVSDVTRDPLRFRLQIGEHFMTIVDLPGVGES--TEYAALYREQLPRLDLILW---LIKA---DDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKICLLHELF-CAVSVRLQWGLRVMAERMIKCL... 216
17 -14.000[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  11  130........VGLAGPPGAGKSTVANEVVRRVNKLWPQKAASFDAEVNPPDVAIVLPMDGFHLYRSQLDAMEDPKEAHARRGAPWTFDPALLLNCLKKLKNEGSVYVPSFDHGVGDPVEDDIFVSLQHKVVIVEGNYILLEEGSWKDISDMFDEKW------FIDVNLDTAMQRV.......... 288
18 -14.000[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  11  18........IVIVGPSGAGKDTLMDYAAAQ------HFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAAVYRHLEAGDVVIANGSR---------------SALPHFGTAFSRLKVVNIVARPDVLARRLEQRGRESRDDILRRLERSSLAVAGDFDVTTVNSGAIEDAGKTIMQVLQ.. 191
19 -13.500[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  11  8.KLEQPVFLIVAGPNGSGKSSVYANADLELEG---RSVWIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVL---------STDKYRRLVEAAEAVGFAIWLFYTV----------------LDSPERSIERIKLRVAKGGHD---VPADKVRARYARSLDQLP.. 156
20 -13.000[G] COG3265 Gluconate kinase  ali follow..  4......KCIIVMGVSGTGKSCVGQALALALGAKFIDGDDLHPRANIQKMAAGQPLNDQDRAPWLERLSDVAYSLQQKNEVGFLVC--------------SALKKQYRDRLREGNEGIRFLWLTGDYDLVLHRMQQRAGHFMPESLLKSQFATLGSDEPDVIPIDISSSIADVVEHCIAALS.. 167
21 -12.500[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  14  35LDLPAGSRCLLVGANGSGKTTLLKILA--GKHMVGGKNVVQVLSRSAFHDTQLVCSGDLSYLGGSWSKTVGSAGEVPLQGDFSAEGTDPVRREKLIDLLDINLQWRMHKVSQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDQRGATIVYATH----DGLETWATHLAY. 221
22 -12.500[E] COG4917 Ethanolamine utilization protein  ali follow..  37  1.....MKRIAFVGSVGAGKTTLFNALQGN.......................................................................................................................................................... 24
23 -12.400[R] COG0645 Predicted kinase  ali follow..  4........AVTHGVSAVGKSQVAMRLVEAAVRLRSDIERKRLFGEQPEHDRGQFAAGISQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQ---------NQRQAACHIAEETGVPFLILCQAPEAVIAGWLAQRQAEGKDPSDATLDVIRTQQAT-KRVDTHDAASLDGLVDGIRQRLP.. 183
24 -12.300[R] KOG4622 Predicted nucleotide kinase  ali follow..  14  21........CVLCGLPAAGKSTFARALAHR-VVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLEYFLMATKTAVSRPLFLVLDDN---------FYYQSMRYEVYQLARKYSLGFQLFLDCPLETCLQRNGQRPQALPP-----ETIHLMGRKL.......................... 209
25 -12.100[F] KOG0707 Guanylate kinase  ali follow..  11  132VRGNAEKPIVISGPSGVGKGTLISMLPSMFGFSVSHTTRSADKKVMEKEIKDGKFLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGA----------------RSVRASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEG-LILYNDNLEECYKKLKVNHLL. 320
26 -12.100[T] COG5635 Predicted NTPase (NACHT family)  ali follow..  18  52......PCLVLLGEPGVGKTHELEKLQRFTEETICEYSKVLG----------LNLRTFTNLKEDLFRDKTFSDWLEGHYHLHLFLD-SLDEGLLNVKSLAIGLVDEFKKPKYRSHINRLHLRL----------TCRTLAFPSI--LEEALKALWEESNFAIYELAPLR-RIDVINAVEAEGFS 204
27 -12.000[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  57FSTEVKPRILLMGLRRSGKSSIQKVVFHK----MSPNETLFLESTNKICREDVSNSSFVNFQQIDFFDPTFDYEMIFRGTGALIF---VIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFTSIYDHSIFEAFSKVVQKL... 237
28 -11.900[G] KOG3354 Gluconate kinase  ali follow..  14  10.NQPYKYVFVVIGPAGSGKTTMAKAVSEKLGFEYIEGDDLHPKANIEKMSQGHPLNDNDRWGWLHNCGGACAMELDKESIKGVVLTCSAL--RSYRDILRSSLEHRPAIL-------RFIYLAASRETLIKRTTSRKNHYMKADMVESQLAIL-DEKDVITISV-ENGKEQSEEECLDIVH.. 184
29 -11.700[R] COG1660 Predicted P-loop-containing kinase  ali follow..  25  1MSDKHINLVIVTGMSGAGKTVAIQSFEDLGYFTIDNMPPALVPK........................................................................................................................................... 44
30 -11.700[H] COG0237 Dephospho-CoA kinase  ali follow..  19  1....MTLVIGLTGGIASGKSTVANMLIEKGITVIDIIAKQAVEKGMPAYRQIID-----EFGEDILLSNGD-------------IDRKKLGALVFTNEQKRLALNAIVHPAVRQEMLNRR------------DEAVANREAFVVLDIPLLFESKLESLVDKIIVVSVTKELQLERLMKRNQLT 151
31 -11.700[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  15  64AREGNVPNIIIAGPPGTGKTTSILCLARA-----PALKDAMLE-------NASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDE--------ADSMTDGAQQALRRTMEIYSKTTRFALAC----------------NASDKIIEPIQSRCAVLRYT--KLTDAQILTRLMNVIEKERVP 212
32 -11.600[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  15  4........VAVTGGIATGKSTISKVFERQGIPVIDKIAREIVEPGQPCWRQIRE-----VFGDEVLLPSKEINRAVLGK--MIFEDRGKLNKITH------TIHRKIFWQVCKLLVTGHAWIVLDLPLLFETGVLMD---------------------IHKIVCVTCDSDKQLERLIARNELS 151
33 -11.600[L] COG0470 ATPase involved in DNA replication  ali follow..  18  41VDEGKLPHLLFYGPPGTGKTSTIVALARE-----KNYSNMVLELNASDDRG-------IDVVRNQIKDFASTRQIFSKGFKLIILDE--------ADAMTNAAQNALRRVIERYTKNTRFCVLA----------------NYAHKLTPALLSRCTRFRFQ--PLPQEAIERRIANVLVHEKLK 188
34 -11.500[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  16  31.RLMKPLVVFVLGGPGAGKGTQCARIVEK-HLSAGELLRDERKNPDSQYGELIEK--PVEITISLLKREMDQTMAANAQKNKFLIDRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDD-NRESLEKRIQTYLQIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFD.. 225
35 -11.500[S] COG5324 Uncharacterized conserved protein  ali follow..  14  394........IFPISVIGCGKTTTSQTLVNLFPDSWGHIQNDDITGK-----------------DKSQLMKKSLELLSKKEIKCVIVDRN............................................................................................... 456
36 -11.500[E] COG0703 Shikimate kinase  ali follow..  13  66EKMAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFRDR----EEKVINELTEKQGIVLA-------------TGGGSVKSRETRNRLSARGVVVYLETTIEKQLARDKKRTPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLE.. 238
37 -11.400[R] COG1084 Predicted GTPase  ali follow..  11  164.......TVVIAGFPNVGKSTLLRTLTGAEPEVYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEDELQAMVALENIADVIMF---IFDASETCGYTLESQYSLYLGIRSVFDIPVVTVF-------------NKMDLAENVKYLEEYINMVEDP-LKVSAFEGRGVSKIIKKLEGLYE.. 326
38 -11.300[F] COG1102 Cytidylate kinase  ali follow..  15  8........ITVSGLAGSGTTTLCRNLAKHYGFKHVYAGLIFRQMAKERGMSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVIEGR-MVKNADLKIWLDAPIRVRAERVAKREGISV------------AFMKIAEREMQNRKRYLNLYGIDINDLSIYDLIIDTSSPEGVFAIVKAAID.. 175
39 -11.200[H] COG2087 Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase  ali follow..  17  2..TDKNRSVFILGGARSGKSRFAEELAGKGRAWDDEMRDRISHHQERRGGEWTTHEAPVDIATVL--------QRLDSPDSVILIDTLWLTNLMMENADMETAFAELEAAIVSTRAKLILVSNEVGLGIVPENRMAREFRDHAGRLHQRVAAIAGEVYFVAAGLP.................. 168
40 -11.100[R] COG3044 Predicted ATPase of the ABC class  ali follow..  11  237........TLIVGGGFHGKSTLLTALERSVYNHIPGDGRERMVTDRAEEGRCVHNLNLSNYINHLTSQSAWLQESIEAGVTTLLIDEDT---------------SATNFMIRDERMQALV----------------SKGEEPITPLVDRIGQLRDDLGISTLVVMGGDVADTVIQM....... 401
41 -11.100[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  17  95........ILLVGQYSTGKTTFIRYLLESDFPVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTGILSGEKQRIDRGYDFTGVLEWFAE--RVDRIILLF---------DAHKLDISDEFKRCIEALA----------------GNEDKIRIVLNKSD.. 256
42 -11.100[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  28FSLRAGEFKLITGPSGCGKSTLLKIVATSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPWQIRNRQPD-----LDFLERFALPDSILTKNIAELS---EKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQ.. 211
43 -11.100[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  16  67TNENKLPHLLLYGPPGTGKTSTILAVARK-----PKYRNMILELNASDDRGIDVVRQQIQ-------ASTQSFSLGKSSVKLVLLDE--------ADAMTKDAQFALRRVIEKYTKSTRFALIG----------------NHVNKIIPALQSRCTRFRFA--PLDGVHMSQRLKHVIEAERLV 216
44 -11.100[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  11  8........VGVSGASCSGKSTLCQLLHAIGSSLVHEDDFYKTDAEIPVKNGIADWDCQESLNLDAFLENLHYIRDPTLEQHLVFVDGFMM----------------YVNEDLINAFDIRLMLVTDFDTLKRRREARTGYITLEGYFENYVWPGYVHGRIQLSPSSKMSVRDNVQWAINSI... 225
45 -11.000[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  11  50QRGDALDHVLIFGPPGLGKTTLANIIANEMGVNLRTTSGPVLEKAGDLAAMLTNLEP----HDVLFIDEIHRLSPVVEEILYPAMEDYQLDIMI---------GEGPAARSIKLDLPPFTLIGATTRAGSLTSPLRDREFYQVADLEHIVSRSAKCLGLEL--------PEGAHQLARRSR.. 217
46 -11.000[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  15  344LTIKRGELLFLIGGNGSGKSTLAMLLTGL---YQPQSGEILLDGKPVSGEQPEDYRKLAVFTDVWLFDQLLGPEGKPANPQLVEKWLAQLKMAHKLELSNGRIVNLKLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQEMGKTIFAIS----DHYFIHADRLLEMR 523
47 -11.000[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  10  126.PKQGGSILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDHMFPYQSQIAVFKEFLLRATKMLGDDLRTDKKIILVE----DLPNQFYRDSHTLHEVLRKYVRIGRCPLIFII----------SDSLSGDNNQRLLFPKEIQEECSISNISFNPVAPTIMMKFLNRIVTIEANK 309
48 -11.000[T] COG1493 Serine kinase of the HPr protein, regulates carbohydrate metabolism  ali follow..  28  149........VLITGSSGVGKSETALDLVRRGHRLVAD................................................................................................................................................... 176
49 -10.900[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  22ERIPSGGITSIIGPNGAGKSTLLSIMSDSGNVLFNGLDVAKTSGDKLATILSVLRQENHFTSRLTVSDLVGFGRYPYSRGRLNKNDRQHIDAAMEFLNLMPLKDRYLDELSQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADELHKTIILV---DINFASAYSDHIIAMK 210
50 -10.800[R] COG2229 Predicted GTPase  ali follow..  47  5.......KIIFTGPVGVGKTTAIAAISD........................................................................................................................................................... 25
51 -10.600[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  50FRRTKSNTVLLSGLSGSGKTVLFYQLRD--------------------GSSHQGAVTSMEPNEGTFVLHNENNTKKGKVKPVHLIDVP---------------HSRLISKLEEYLPRAAAVV-------FVVDALEFLPRAASEYLYDILTNASVIKNKTPVLLCCNKTDHTKEFIRKQMEKE 197
52 -10.600[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  33  1..MKRPLIIGVGGPVGAGKTMLIERLTRY.......................................................................................................................................................... 27
53 -10.500[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  12  27LEVPEHQFLTVIGSNGAGKSTLLGAVTVGGQVLIANLCARVFQDPLAGTCGALTIEENMALAYMRGKKRGWSLALSNQRRKLF---QERISILGLGLEDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKEFNLTVMMVTALACGDRTVML....... 222
54 -10.500[T] KOG3886 GTP-binding protein  ali follow..  11  36.NTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLLWDCGVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCL-----VHKMDLVQEDQRDLIFKEREEDLRRLSRCSCFRTSIWDETLYKAWSSIVYQL... 241
55 -10.500[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  11  433LEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKP------SSGMVEVVVDSIAAMIPSELEPQITEKSILEQIFDITGDIHLAVEVLNRAGISDAVLYRARFNELSTGQKERFKLLAKKPSLMLVDEFAAHLDEMTAVRVARKISELAREAKITLIAVTNALSPDRILYV....... 611
56 -10.500[R] COG3910 Predicted ATPase  ali follow..  13  39........TFFAGNNGSGKSTLLEGLAA-------------GMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLDRRSHGEGFL--DIMHRRLHGAGLYFLDEPESPLSQKQLELAAIIR.. 197
57 -10.500[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  12  32LSADCMPHLLFCGPSGAGKKTRIKCLLREKSFTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTSQIEKVVVLCE--------ADSLTRDAQHGLRRTMEKYANNCKIVLSC----------------ESLSRIIEPLQSRCII--INVPAPTDEDVTKVLRKVIERESFL 208
58 -10.500[R] KOG1673 Ras GTPases  ali follow..  15  103.......KISLLGDCQTGKTTFVKYVGDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGGDEKRSKDHIPIACKDAVAILFMFDLTSRSTL-------NSVFGWYSQARKWNKTAIPILI--------KFDDFVRLPPNLQWTIVTQARAYAKVMNASLFFSSATNVNKIFKFILARL... 266
59 -10.500[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  11  22FTVDKGDIVTLMGPSGCGKSTLFSWMIGALAEQFSCTGELWLNEQRAQRQIGILFQDALLFDQFSVGQNLLLALPATLKGNARRNAVNDALERSGLEGAFHQDPATLS---QRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALAIPVVQVTHD--LQDVPADSSVLDMA 207
60 -10.400[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  10  78IVGRPANNVLMSGARGTGKSSLVKALLHEYAD-LIEVDKSDLIG-----------------------PYLLTLLKECPEKFIVFCDD----SFESGDETYKALKTALDGGLSQRCANVLVYATSNRRHLMPEYFDENAGEIHQKEAVEEKISLSDRFGLW-LSFYPFDQNDYLAAVQNWLE.. 241
61 -10.400[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  12  526LCIEPGVHLLITGPNGCGKSSLFRILSGL---WPIYAGELHIPRPVKDVPCMFYIPQRPYMSIGSLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHIAQRDSFDVV-EKQRMAIARLFYHRPRYALLDECTSAVSID----VESSIYEIAKGMGITLLTI-----THRPTLW-HILEFD 708
62 -10.400[P] COG0370 Fe2+ transport system protein B  ali follow..  10  5.......TYCILGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVGTLRSKTGKLIDLYDLNPISRDETVVTRFLLEEKFDCMLVDSSQIERNLN-----------LTVQLLEYGAPVVMGL-------------NMIDVAAGRGIHLNIQNLAKKLRIPILPVVARS-GKGTEDILSTL... 157
63 -10.300[R] COG1160 Predicted GTPases  ali follow..  16  5.......VVALVGRPNVGKSTLFNRLTRTRDALVADLTRDRKYGHAHIAGYDFIVIDTGGID----GTEEGVEEKMAEQSLLAIDEADIVLFLVDARAGLTAADIGIANYLRQRQNKITVVVANKT------DGIDADSH----------CAEFYQLGLGEIEQIAASQGRGVTQLMEQV... 160
64 -10.300[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  10  38........TLIEGENDTGKSVLCQQFVYGGYYTTENTIKSFLRQMESLSLDVSDFYAWGYLRVFPVHLEGIDWSTEQMRSNIAIID----SLTMFTTYSTEDDVLEFLTRLKNLCDNGKTILIT----------------LHQHAFKEDTLVRIRSACDCHLFLRKEQVGDRYVSVLEVSKIR 214
65 -10.300[R] KOG1533 Predicted GTPase  ali follow..  10  36........VLVIGAPGAGKSTFCAGLTD----IFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANC-----------NWLLQKIEANHKKYLIIDCPGQLELYKSEGE------------WKVIRFLEKSGVRLCALPSKFISVALSTLATMVTME 194
66 -10.200[L] COG0507 ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member  ali follow..  10  53LKGGRSQLFRLFGYAGTGKTTLARHFAEN-VVFAAFTGKAAQVLRSKGATNAKTIHSLIYRPRGEEEVEDEETGKTSAKAALIIVDESMVDEALGKD-----------------------LMSFGTPILVLGDPGQLPPVSGGGYFTNHEPD------FLLTDIHRQARDNPIIQLAMQVR.. 221
67 -10.200[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  14  26LTIPKGEITVFIGSNGCGKSTLLRSLARL---MKPRGGSVLLE-----GRAIAKLPTKEVAKELAILPQGPSAPEGLTVHQLVKQDEEAVERALKATKLEDMADRAVDSLSQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEKEDRTIVMV---DLNLACRYAHHLVAIK 216
68 -10.100[K] KOG1534 Putative transcription factor FET5  ali follow..  14  6........AFVCGVASSGKSTFCGALMS----YMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENL-----------DWLNEEIGDYDEDYLIFDMPGQIELYTHVPI-------LPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVL... 155
69 -10.100[F] COG0194 Guanylate kinase  ali follow..  11  48........IVLSGPSGVGKGTVRQAIFSQSISVTTRSPREKTRDEFEQMIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLEIEV------------------ALQVRNAFPEGLFIFLAPPSLSELKNRIVTRGTETDALIENRMKAAKAEIEMM-YVVENDNVETACDKIKAIVLAE 226
70 -10.100[H] COG1072 Panthothenate kinase  ali follow..  10  83........ISIAGSVAVGKSTTARVLQAL-VELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIP......................................................................................... 176
71 -10.100[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  10  12WNKKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSM--SLCHGIIFIVDSSDRERL-------DECSTTLQSVVMDEEIEGVPILM-------KQDRQDRMEVQDIKEVFNKIAEHISARDSRVLALTGEGVKDAIEWMIVRLE.. 187
72 -10.000[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  14  27LRLLKGHRYGLCGRNGAGKSTLMRAIANGGFPDKDTLRTCFVEHKLQGEEGDLDLVSFIALDEELQSTSREEI-------------AAALESVGFDEERRAQTVGSLS---WKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLE-----DITSLIVS----HDSLDTVCTDI... 190
73 -9.990[H] KOG2743 Cobalamin synthesis protein  ali follow..  10  46.........IITGYLGAGKTTLLNYISKRVAVILNESGEGSALEKSLAVSQGGELYEEWSVKDNGLRAIENLMQKKGKFDDILLETTGLADPGAVASMFWVD-----AELGSDIYLDGIITIV---------DSKYGLKHLTEEKPDGLINEATRQVALDIILINKTDLEEDVKKLRTTIR.. 221
74 -9.980[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  375......QIIVMLGENGTGKTTFIRMLAGAVQSEIPEFNVSYKPQGNDSKRECTVRQLLHDKIRDACAHPQFMSDVIRPLQIEQLMDQVVKTLSG-----------------EKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILHAKKTAFIVEATYLADRVIVY....... 539
75 -9.910[R] COG0486 Predicted GTPase  ali follow..  23  229.......KVVIAGRPNAGKSSLLNALAGREAAIVTDIARDVLREHIHIDGMPLHIIDTAGLREATDEVERIGIVRAWSEIELLMLDST............................................................................................... 317

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 4 3 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review.