current user: public

If you have questions about the server, please let us know.

Query: [F] COG4088 Predicted nucleotide kinase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MPLIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDYRVIIINDESLNIEKETYRESKNEKAARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLYCESKSMYTTHCVIHVAVPQDLCRKFNSNKEQPYPDDVLEQLMFRYEEPNGMTRWDSPLFTVLHDDASCPIDDIWSVLIHNKNVKPNQATMVKPPAEVNYLYELDKTTQDVIMLILDNSNDTSLITVPGSKLQIALPSVTVSLPLLQRLRRQFIQINRQQSYNTNVLKEMFVEFLNGQFETLDLast
1 -103.000[F] COG4088 Predicted nucleotide kinase  ali  100  1MPLIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKDYRVIIINDESLNIEKETYRESKNEKAARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLYCESKSMYTTHCVIHVAVPQDLCRKFNSNKEQPYPDDVLEQLMFRYEEPNGMTRWDSPLFTVLHDDASCPIDDIWSVLIHNKNVKPNQATMVKPPAEVNYLYELDKTTQDVIMLILDNSNDTSLITVPGSKLQIALPSVTVSLPLLQRLRRQFIQINRQQSYNTNVLKEMFVEFLNGQFETLD 281
2 -80.000[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  32  1MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISEN-----AVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPYTRETFDALCQRYEEPQSNNRWDSPLVVVLPKDT-LDMEAIYKALYESQPLPPNQSTYNAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQLRIPGSRNPVKATSMNALQLNRLRQKFITSTCHASQPLEQVPHLFVQFINANTIG.. 298
3 -67.000[R] KOG4622 Predicted nucleotide kinase  ali follow..  14  18RGLCVLCGLPAAGKSTFARALAHRLQQEQGWAIVAYDDVMPDAFLAGARARPAPSQWKIFSAAFEAQSCYLLTKTAVSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQRPQALPPETIHLMGRKLEKPNPEKAWEHNSLTIPSPACASELLTALENPVKYAEDNMEQKDTDRIICSTNILHKTDQTLRRIVSQTMKEAKDEQVLPHNLKLLAEELNKKAEFLEDLKQGNKKYLCFQQTI--DIPDVISFFHYEKDNIVQK.. 352
4 -39.900[R] COG0645 Predicted kinase  ali follow..  11  3..LAVTHGVSAVGKSQVAMRLVEALGAVRLRSDIERKRLF--EQPEHDRGQFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQ....................................................................................................... 180
5 -36.800[R] COG4639 Predicted kinase  ali follow..  13  10..LVVLIGASGAGKSTFARKHFQPF---------------EVISSDFCRGLVSNDENSQSASRDAFDVLHYITTKRLAAGKLTVIDATNVQPEDRKTLLQMAKQYHCFTVAIVFDLPEELCHERNQQRSRQFGSHVVRRHTQMLRRSLEKEGFRYVYTLKSPEEIANVAIELQPLWNNKK..................................................................................................... 176
6 -30.400[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  11  16..VVLLIGPPGSGKSTFCDTAMR--SSHRPWSRICQDIV-------------------NNGKAGTKAQCLKMATDSLREGKSVFIDRCNLDREQRSEFIKLGGP-EFEVHAVVLELPAQVCISRSVKRTGGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDADVDNAVNMY............................................................................................................. 170
7 -26.500[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  13  25..LILLNGGSSAGKTSLALAFQDLAAECWMHIGIVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFE--GCRVWMVGVHVSDEEGARRELER----GDRHPGWNRGSARAAHADAEYD-----FELDTTATPVHELARELHESYQACPYPMAFNR.......................................................................................... 218
8 -24.000[S] COG5324 Uncharacterized conserved protein  ali follow..  12  393..LIFPISVIGCGKTTTSQTLVNLFPD----GHIQNDDI--------------------TGKDKSQLMKKSLELLSKKEIKCVIVDRNNHQFRERKQLFEWLNELKEDYLVYDLSEIRDITLQRVIKRGNNHQVGIMNGFLKRYQPVNLDKSPDNMFDLMIELDFGQADSSLTNAKQILNEIHKAYPILVPEIPKDDEIETAFRRSLDYKPTVRKIVGKGNNNQQKTPKISAKIENYDEIIELVKRCKELHITLGHVMSSREKEAKKLWKSYCN....... 696
9 -22.000[G] COG2074 2-phosphoglycerate kinase  ali follow..  10  93..IILIGGASGVGTSSIAFEVANRLGIRNMISTDMIREVMRKIVSRELLPSIYESSYTADHVESVSIGVEAVIERALTEGISIVIEGVHIVPGF---IREDLVNKENVAMFVLTVSDENVHKGRFYSRCRQMWARRPLKRYISIHRYIENQARKHGVPVIENIDVVTTIDSIIKSLTKTTVKGGEKGAEKTE......................................................................................... 306
10 -20.600[G] COG3265 Gluconate kinase  ali follow..  15  4.KCIIVMGVSGTGKSCVGQALALALGAKFIDGDDLHPR-------ANIQKMAAGQPLNDQDRAPWLERLSDVAYSLQQKNEVGFLVCSALKKQYRDRL----REGNEGIRFLWLTGDYDLVLHRMQQRAGHMPESLLKSQFATLEAPGSDEP-------VIPIDISSSIADVVEHCIAALSLENHVSAILSE......................................................................................... 178
11 -20.500[G] KOG3354 Gluconate kinase  ali follow..  13  16..VFVVIGPAGSGKTTMAKAVSEKLGFEYIEGDDLHPK-------ANIEKMSQGHPLNDNDRWGWLHNCGGACAMELESIKGVVLTCSALKRSYRDILRSSLEHRPAILRFIYLAASRETLIKRTTSRKNHMKADMVESQLAILEAPTADEK-------VITISVENGKEQSEEECLDIVHKMVNENKQ............................................................................................ 192
12 -20.500[F] COG2019 Archaeal adenylate kinase  ali follow..  11  1M-RSVITGVAGVGKTTVLDIVARESG-----PVVNYGTLMFEVAKRRGLVENRDQI--RKLSRETQVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWV----VFVIIEADPAIIKRRRDNDPTR-GVDSIREHQEMNRYFAAAYSIFSGATVKIVKNEEGKPEQAADEIVR....................................................................................................... 178
13 -18.200[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  15  14..FLIVAGPNGSGKSSVYANADLELEGR-SVWIVNPDLLAGRISEVENKP-------LPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTDKYRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAKVPADKVRARYAR.......................................................................................................................................... 150
14 -17.500[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  10  3LPNILLTGTPGVGKTTLGKELASKSG------------LKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHI---------VFVLRTDTNVLYERLETREKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS............................................................................................. 172
15 -17.300[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  14  17..MIVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDAGAFAVIPAAVYRHLEAGDVVIANGS-------RSALPHFGTAFSRLKVVNIVARPDVLARRLEQRGRESRDD----ILRRLERSSLAVAGDFDVTTVDNSGAIEDAGKTIMQVLQQSAGSSQ................................................................................................ 198
16 -16.900[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  15  84..VICVEGPIAAGKSKFAKELAEELDMEYYPAVDLDLKLDPQLPPSCRSYDVRNFCLDPSHDLAAQFQIRDALQHVLSTGQGVVLERQGYLSRGARSVYNTIGELLKPHLVIYLDLPVDAVKKQIKARNVDFSDAYLSDLEQLYKQQYLKDISTHAELLIYDWTAGGETEVVVEDIERIDFNQFEADIHNKKMLDWRFPLEAE.............................................................................. 331
17 -16.800[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  12  5..VLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSD---------FSDADRVENIRRVGEVARLMADAGLITPVSFISPFREERDQVRARLP--EGEFIEIFIDTPIEECMARDPKQALRGEIKAFTGIDSPYEPPVAPE--------LRLNTAGRTVDELIAEVEN....................................................................................................... 167
18 -16.400[F] COG1428 Deoxynucleoside kinases  ali follow..  12  8..VIVLAGMIGAGKSSYTELIANELGTKAFYESIKDNRILEMFYDDPKRWAFALQIY--RSIKAALTDQNNVLDRSIYEDALFNFEEGNISEPEMDTYLDLLDNMMEELLLIYLRGSLDTVLSRISLRGRPYEQTFYKHLHSRYDS---ESYDKSDTLVINIDEVDINKPSDAKYVMQL...................................................................................................... 207
19 -16.000[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  15  3...IAITGTPGVGKTTVAKLLAKKLNYEYVSLKDFALEKGCGRRVNDEVEVE--------------DELAYFIERELKGKNAVL-------DGHLSHLMPVD-------LVVVLRAHPKLIGERLRERGYD-REKIGENVEAELVDAVLIEAIEEHENVIEVDTTNKSPEDVVEEIVS-------NSGIKKRVGIVDWSEVYDEIIP.......................................................................... 173
20 -15.800[R] COG3911 Predicted ATPase  ali follow..  12  9...FVLTGGPGSGKTTLIAALRRA-------FATSVVAGRGIVRDQSSIGGTALPWSDRTLAELMLSWEMRSYQNAVEQKGPVFFDRGLSGLPVADHVSTAAKRFRYNP-RVFIAPPWPDIFAQDEERKQTPDEA--KCTYHALA--EIYTELGYELVPLPLAPVETRLRFVLADA......................................................................................................... 180
21 -15.700[F] COG0572 Uridine kinase  ali follow..  15  10..IIGIAGASASGKSLIASTLYRELREQVGDQHIGVIPEDGYYKDQSHLSMEERVKTNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIIL-IFVDTPLDICLMRRMKRDVNERGRSMDSVMAQYQK....................................................................................................................................... 170
22 -15.600[G] KOG0234 Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase  ali follow..  12  40..LIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKANGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVK--RENVMEDFLKRIEC--------KVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSHVKRTIQESLGVPYEQWKILNEIDAGVCEEMTAEIEKR. 343
23 -15.300[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  13  117..VVWITGLSGSGKSTVACALSKALFERGKLTYTLDGDNVRHGLNRD---------FKAEHRTENIRRIGEVAKLFADVGVICIASLISPYRRDRDACRSLLPD---DFVEVFMDVPLHVCESRDPKLARAGKIKGFTGIDDPYEAPVNCEVVLKHTGDDESCSPRQMAENIISYLQNK...................................................................................................... 288
24 -14.700[F] COG1102 Cytidylate kinase  ali follow..  14  5CLVITVSGLAGSGTTTLCRNLAKHYGFKHVYAGLIFRQM-----AKERGMSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVIEGRL------------MVKNADLK---IWLDAPIRVRAERVAKREGISVEEAFMKIAERYLNLYGIDINDLSIYDLIIDTSKWSPEGVFAIVKA....................................................................................................... 172
25 -14.200[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  14  37..VVFVLGGPGAGKGTQCARIVEKYGYTHLSA----ELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSSDDNRESLEKRIQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQ....................................................................................................... 222
26 -14.000[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  10  8VRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRD-------YVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDKYEGREHPFVQALIDEYRFDLVIL-LENNTPWVADGLRSLGSSVDRKEFQNLLVEM-----LEENNIEFVRVEEEDYDSRFLRCVELVRE....................................................................................................... 181
27 -13.900[F] COG0563 Adenylate kinase and related kinases  ali follow..  15  1MNLILM-GLPGAGKGTQAEKIIEKYG-----PHISTGDMFRAAMKNETELGLKAKSYMDAGELVPDEVTIGIVRDRLSQQNGFLLDGFPRTVAQAEALEDILASLDKKLYVINIDVPEQLLMDRLTGRRVSPTSGRTYHVIFNPPKVEGICDVDGSELIQRDDDKPETVKKRLEVNQKQAQPLIDFYSEKGYLQNINGDQDISRVFEDINELLKGLSS............................................................... 217
28 -13.700[R] COG4128 Zonula occludens toxin  ali follow..  1MSIFIHHGAPGSYKTSGA--------------------------------------------------LWLRLLPAIKSGRHII---TNVRGLNLERMAKYLKMDVSDISIEFIDTDHPDGRLTMARFWHWARKDAF--FIDECGRIWPPRLTVTNLKALDTPPDLVAEDRPESFEV-----DMHRHHGWDICLTTPNIAKVHNMIREAAEIGYRHFNRATVGLGAKDAANSGQMDSHALTRQVKKIPSPIFKMYASTTTGKARDTMAGTALWKD...... 224
29 -13.500[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  19  129..LVGLAGPPGAGKSTVANEVVRRVNKLWPQKAASFDAEVAIVLPMDGFHLYRSQLDAMEDPKEAHALLLNCLKKLVSLQHKVVIVEGNYILLEEGSWKDISDMFDEK---WFIDVNLDTAMQRVENRSTGKPPDVAKWRVDYNDRPN..................................................................................................................................... 313
30 -13.500[F] KOG3078 Adenylate kinase  ali follow..  18...AVLLGPPGAGKGTQAPRLAENFCVCHLAT----DMLRAMVASGSELGKKLKATMDAGK-----EMVVELIEKNLETKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATS............................................................... 232
31 -13.400[F] COG0194 Guanylate kinase  ali follow..  12  47..LIVLSGPSGVGKGTVRQAIFSQEDTKFEYSIKTRDEFEQMIADNKLLE--------AEYVGNYYGTPVDYVEQTLQDGKDVFLE---------QGALQVRNAFPEGLFIFLAPPSLSELKNRIVTRGTETDALIENRMKAAKAEIEMMDAYD---YVVENDNVETACDKIKAIVLAEHLKRERVAPRYKKMLEVE.................................................................................... 244
32 -13.200[H] COG1072 Panthothenate kinase  ali follow..  14  82..IISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLVVQPDILILEGLNVLQSHDPHHVFVSDFVDFS---IYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHN....................................................................................................................................... 253
33 -13.200[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  67..LVGLAGPSGAGKTIFTEKILNFMPSI------------AIINMDNYNDGTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEVPSSRIVILVSVTGGVHFDLVKRVLRDIQRAGQEPEEIIHQI......................................................................................................................................... 213
34 -13.000[R] COG0714 MoxR-like ATPases  ali follow..  12  36...ALLEDVPGVGKTLLAKSLARSINGKFQRVQCTPDLLPTDITGTNIWNPSSREFEFLPGPAFANILLADEINRATPRTQAALLEV---MEEKQVTVDGETRLVPHPFFVIATQNPIE------YQGTFPLPEAQLDRFALSLSLGYPSEAEELKMLQRQQNPEAIAVGDLESCISLEEVEALQKAVRQ----------KLTEDLQQYLLRLVRASRTDE---------DVTLGVSPRGTTALQRATQAFAFLEERDYAIDDDVKFVAPHVLAHRL.... 282
35 -13.000[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  13  7..IVGVSGASCSGKSTLCQLLHAIFEGSSL-ESLNLDAFLENLHYIRDHGVLPTHLRNRENKNVAPEALFKAPAIPTLEQHLVFVDGFMMYVNED-----LINAFDIR---LMLVTDFDTLKRRREARTGYITLEGF................................................................................................................................................ 166
36 -12.700[F] KOG0707 Guanylate kinase  ali follow..  12  139..PIVISGPSGVGKGTLISMLMKEFPSMFGFSVADKKVMEKEIKDGKFLE--------ASVHGNLYGTSIESVEAVTDSGKRCILD----------QGARSVRASSLDAIFIFVCPPMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIFGLILYNDNLEECYKKLKVNH......................................................................................................... 318
37 -12.200[F] COG1618 Predicted nucleotide kinase  ali follow..  11  10MLRIAVTGSPGVGKSTVVAKTAEKLAEKPGRTAEIRKEGHREGFSIRDLATGKTGILSHVKGSDDLERIGANAVRNALACDLVVIDEIGPMELISQSFVSAVEEVDKPVLAVLHHSSRHPLAQRDKGNRDELPEKITNRFLRKL......................................................................................................................................... 183
38 -11.900[F] COG0125 Thymidylate kinase  ali follow..  17  5..FITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREQIREVILNENNILMDPKTEALLYAAARR-QHLVEKVKPALEQGFIVLCDSPLAYQGY-LSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRL................................................................................................................................................. 157
39 -11.900[E] COG0703 Shikimate kinase  ali follow..  11  74...IFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGW----DLEGEEGFRDREEKVINELTEKQGIVLATGGGSVKSRET---------RNRLSARGV---VVYLETTIEKQLARTQRDKKRVETPPREVLEALANERNPL----EEIADVTIRTDDQSAKVVANQIIH....................................................................................................... 235
40 -11.600[C] COG3954 Phosphoribulokinase  ali follow..  7..VIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEHTFIEYGQTGKGQSRKYLHTYDEAVPWNQVPGTFTPWQPLPEPTDVLFYEGLHGGVVTPQH--DVARHVDLL---VGVVPIVNLEWIQKLIRDTSERGHSREAVMDSVVRSMDDYI................................................................................................................................. 191
41 -11.400[R] COG3596 Predicted GTPase  ali follow..  39.PVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGVGESGVRDTEYAALYREQLPRLDLILIKADDRALATDEHFYRQVIGEAYRHKMLFVISQSDKA---EPTSGGNILSTEQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREPSSPVVALLQHPFRTWVAREQARDDFGETVDTILDTVSTFPLIPAPVRTIIQAVRSSVVSVAR................................... 282
42 -11.400[R] KOG2486 Predicted GTPase  ali follow..  11  135LPEFALVGRSNVGKSSLLNSLVRRKRLALTSKK-KTQCINHFRINDKWYLVDLPGYGYASAPHELKQDWNKFTKDYFLNRSTLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCD--------KRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQ....................................................................................................... 310
43 -11.400[K] COG1224 DNA helicase TIP49, TBP-interacting protein  ali follow..  15  66...ILMAGPPGTGKTAIAVAISKELGKDIPFVQVSASEFYSAEMKKT---------------EALIQAMRKAIGVRIRETRTVLEGEVVGLDYNMVP........................................................................................................................................................................................ 144
44 -11.200[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  65...ILLMGLRRSGKSSIQKVVFHKMSPN--ETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGALIVIDSQDDYMEALARLHLTVTRA---------DINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSIYDHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIAT-LKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTK-FLALVCFVREESFERKGLIDYNFHCFRKAIHE.. 366
45 -11.200[R] COG1373 Predicted ATPase (AAA+ superfamily)  ali follow..  49.RIYTLRGPRQVGKTTLVKLIIRELLETIEH-------------SQSIFYFTCDLVADEKELFEVLDLYLKWAAAFRLERKYIFLDEISSVRDWEKGLKYLVDTGALNNATVVLTGSHSIDIKSSIERRGEGEGTLDKIFMKFSEYAETLNSDLKQFMEANGLFEAEKRQEILSNLSEGRADPLLNMLLLYQPELDRLFDQDSSIYEIYIQSLIGDLARWNIPEMPVKQTLRSIAGKLTTPVSWRSITDET--------IGAHVTVRKYVTALEDSF.... 330
46 -11.000[T] KOG0609 Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase  ali follow..  13  349...LVLIGVSGVGRRTLKNRLINSDVDKFGAVIMDREEMEEAVRNNEFLE--------GEHNGNLYGTHLQSIKDVINSGRMCILDCA-------NALKILHNSQELMPFVIFVAAPMEQLKTIYADRRATGSNRNLSATLVALL--DLCLNTQTLLNTFAFYDFSEQDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQ............................................................... 568
47 -10.800[E] COG4917 Ethanolamine utilization protein  ali follow..  16  1MKRIAFVGSVGAGKTTLFNALQGN---------------YTLARKTQAVEFNDKGDIDTPGEYFNHPRWYHALITTLQDVDMLVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDA.................................................................................................................................................................. 106
48 -10.800[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  12  20...ILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLC--HGIIFIVDSSDRERECSTTLQSVVMDEEIEGVPILMLANKQ.................................................................................................................................................................. 135
49 -10.700[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  13  58...VLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTKKGKVHLIDVPGHSRLISKLEEYLPRA--AAVVFVVDALEFLPNIRYDILTNASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRV........................................................................................................................................... 203
50 -10.600[T] KOG3886 GTP-binding protein  ali follow..  43...VLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQ-RFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVIYVFDVES-MHYYQSCLEAILQNSP--------DAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTS--NTYVMVVVSDPSIPSAATLINIRNARKHFEK.. 360
51 -10.600[P] COG0370 Fe2+ transport system protein B  ali follow..  11  6...YCILGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVGTLRSKTGKLIDLPGIYDLNPISRDETVVTRFLLEEKFDCMLNIVDSSQ-----------IERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGIHLNIQNLAKKLRIP----------ILPVVARSGKGTEDILSTLSEKHVAPAIPLVLQYGEPAEKAIKEIQALTKELIPAK--QSRWLAIQFLSKNEVTEAFLTSNSAFEQLQQIRAELESELNGKL--ENHFHQVRASYIHDICLT.. 256
52 -10.500[R] COG1660 Predicted P-loop-containing kinase  ali follow..  10  6INLVIVTGMSGAGKTVAIQSFEDL------------------------------FTIDNMPPALVPKFLELIEQTNENRRVALVVDSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRYKETRRSHPLAADGRVLDGIRLERELLSPLKSMSQHVVDTTKLTPRQLRKTISDQFSEGSNQASFRIEVMSFGFKYGLPLDADLVFDV-QVELREKTGLDEDVFNYVMSHPESEVFYKHLLNLIVPILPAYQKEGKSVLTVA-AFAHCLAESLAT.. 275
53 -10.500[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  66.KVVVILGATGAGKSRLSVDLATRFPSEIINSDKIQVYEGLEITTNQITLQDRRGVHGELTAGEFRSAASNVVKEITSRQKVIIAGGSNSFDPFSSGSCLISSDLRYECCFIWVDVSETVLYEYLLRRDEMMDSGMFEELSRFYDPVKSGLETRFGIR------KAIGVPEFDGYFKEYPPEKKMIKDALRKAAYDKAVDDIKRNTWTLAKRQVKKIEMLKDAGWEIERVDA--------TASFKAVMMKSSSEKKWRENWEEQVLEPSVKIVKRHLVQN. 357
54 -10.400[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  37MPHLLFCGPSGAGKKTRIKCLLREL-IMKSFTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTS-RSFKVVVLCEADLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSR-PAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEG-NLRRAILMTEALRMENESGVAESVVIPVPEWEIYIQETARLILQKQSS--------------------------DMLLKVRERLYELLSRC-IPPTVIFKKLLEHLLPKCPPQ. 309
55 -10.400[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  51IHSMILWGPPGTGKTTLAEVAANYANAEVERVSAVTSGV-----------------------KEIRAAIEKARENKLSGRRTIFVDEVHFNKSQQDAFLPHIEDGTVTFIGATTENPSFELNNALLSRAR--------------------------VYKLTSLNQQEILQALHQAIADTERGLGKVAAVFADNVLDRLAELVNGDARMSLNYLMAREDDQGRKQIDLPLLAEVAGEKVSRFDNKGDIWYDLISAVHKSIRGSD--PDAALYWAARMISAGC 287
56 -10.400[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  10  41...LLIEGPSGIGKTCVVFKVFEELQWSQGRDFTYVGC------------------RDQNAEQIIDDFLKNAAAGNALSPCVLVIDDFHLSQAKRMEIGSTLKRLPAKVILIGIPTAGVSLLSDAYDLGPRLSDVEIDKLISEGEQALAVLFEDRDVLLAESAGNFWLAQYVCNKVVYETQDDAKILTFDILGIRGRLMAELTQRYLPIARTFAKGKRWRPGGNKPYLEILLALCKIQDSVVTFDQLLQLVSE............................ 295
57 -10.300[S] COG4983 Uncharacterized conserved protein  ali follow..  10  499SAYLFITEETGIGRNWLSSVLVRVLRGYVAAGIDIQE------------------------------MLDGTFNGRLSRKLLAVVDEAKAQGYGRWSHSEKLKS---------MINPEMRRINEKHGLEFVEWNCCRWLFFSNNWDALPFDASDRRFNVVANPTHRQSPDRIYSQIAN------------------------PDFISAVRKRLELLDISGFKPGAIPDMNEAKRKALGAMASDLDNLLAAFRDEWPGPLAERSDVINYLHVSIAKLPGEKT 721
58 -10.200[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  12  1MNIFGITGWKNSGKTTLTEKLVAELVRRGWKVSTVKHAHHDFDIDKPGADSFRHRQAGATELRGEDEPPLESILSRLAPCDIVLVEGYKRESHRKIETRRLEAK................................................................................................................................................................................. 118
59 -10.200[H] COG2087 Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase  ali follow..  15  7..SVFILGGARSGKSRFAEELAGKAGGRLATGRAWDDEMRDRISHHQERRGGEWTTHEAPVD------IATVLQRLDSPDSVILIDCLTLMETAFAELEAAIVSTRAKLILVSNEVGLGIVPENRMAR......................................................................................................................................................... 140
60 -10.200[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  11  36.SLTLIEGENDTGKSVLCQQFVYGGLMSGHNIAYYTTENTIKFYAWGYLRVFPVHLEGIDWSTEQMRSILNLVANHIKT-NIAIIDSLTMFEDDVLEFLTRLKNLCDNGKTILITLHQHAFKEDTLVRIRSACDCHL................................................................................................................................................ 193
61 -9.940[H] COG0237 Dephospho-CoA kinase  ali follow..  13  1MTLVILTGGIASGKSTVANMLIEK-DILLSNGDIDRKKLGALVFTNEQKRLALNAIVHPAVRQEMLNRRDEAVAN---REAFVVLDIPLLFESKLESLVDK---------IIVVSVTKELQLERLMKRNQLTEEEAVSRIRSQMPLEEKTARAD---QVIDNSGTLEETKRQLDEIMNS...................................................................................................... 195
62 -9.680[S] COG2326 Uncharacterized conserved protein  ali follow..  61..VIVFEGRDAAGKGGVIKRITERVSPRVFRVV---------------------ALPAPTDREKTQIYMQRYIQQFPAAGEVVIFDRSWYNREIAPRFEAAMIESGIVLLKYFLDVSEEEQDRRFRQRIND...................................................................................................................................................... 187
63 -9.640[L] COG0470 ATPase involved in DNA replication  ali follow..  12  46LPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMV--------------LELNASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRF----------RFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILE----------DDWGTAHYTLNKVRSAKGLALIDLIEGIVKILED...... 287
64 -9.630[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  10  55LDHVLIFGPPGLGKTTLANIIANEMGVNLRTTSGPVLEKAGDL---------------------------AAMLTNLEPHDVLFIDEIHLSPVVEEILYPAMEDYQLPFTLIGATTRAGSLTSPLRDR-EFYQVADLEHIVSRSAKCLGLELTPEGAHQLARRSRGTPTNRLLRRVRDFAEVRADGAINGEVAMKALDMLNVDAE-LDNLAAAIGEERETIEDVLEPYLIQQGFIQRTPRGRIATNHAYKHFGITREE....................... 334
65 -9.600[LO] COG1474 Cdc6-related protein, AAA superfamily ATPase  ali follow..  10  68...VLIYGKTGTGKTAVTRYVGKELERVSEDKSLTQYRLLANLARHFEEEVPMTGWPTDQVFMKFKEAIDARDQVII-----IILDEIDKLIKKGDDLYNLSR--KAKVSMIGVSNDLKFTEFLDPRVKSSLAEQISDILKQRAKMAYNDGVLGEMVIPLCAAFAAQEHGDARRALLLRVSGEIAERENQPQVLEEHVRRAQEKIEIDRVVEVVRTLPTQSKLVLYSLLRSRGREGKNVTTGEMYNVYRQLCHHIDVDILTQRRVTD-LMSELDM...... 365
66 -9.570[R] COG3910 Predicted ATPase  ali follow..  10  37.PITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKYPKIRMFLEGFLDIMHRRLHGAGLYFLDESPLSPQKQLELAAIIRQAADSGGQLIIATHSPVLLAIPEATIYYFDEDGITE.............................................................................................................................................. 233
67 -9.450[L] KOG2028 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  11  137LPSIVFWGPPGTGKTSIAKSLINSSKDPSLYRFVSLSA-------------------VTSGVKDVRDAVESALNLEGRKRTVLFMDEVHFNKSQQDTFLPVIEDGSILFIGATTENPSFHLITPLLSRCRVLTLNPL---------------------------KPNHVETLLRRAVDDSERGLPNSVEVDDSVIEFLANNCDGDARVALNALMATTRAGTDAVVSIDDAKEALQCKHLAYDKAGEQHYNLISALHKSMRGGD--ANAAIYWLARMLEGGE 377
68 -9.400[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  10  17...IVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDK--------GKVVKEVRQADAIVLDRPETLDRLSKYWLPLFRQLEVRVPIIVAGYEVDN---KEAYNHFSIEQITSALMKQYREVETSIQ-------------SAQRLDQAKDVLYYAQKAVIDPVGPVFDQENNVLKPRCIAALKRIF-LLSDHNMDGILSDEELNELQKKCFDTPLVPCEIKQMKNVMQVTFPQGVNERGLTLDGFLFLNTRLIEEAR 274
69 -9.390[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  72LPHLLLYGPPGTGKTSTILAVARKLYGPKYRNMILE------------------NASDDRGIDVVRQQIQDFASTQ-SSVKLVLLDEADMTKDAQFALRRVIEKYTKSTRFALIGNHVNKIIPALQSR-APLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLSNGDMRKALNILQSTHMASKEITEEESKQITEEDVYLCTGNPLPKDIEQISHWLLNKPFDECYKDVSEIKTRKGLAIVDIVKEITLFIFKIKMPSAVRVQLINDL............. 333
70 -9.360[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  1MFIVAVTGGIATGKSTISKQIREVFGDEVLLPSINRAVLGKMIFEDKELRGKLNKITHPTIHRKIFWQVCKLLVT---GHAWIVLDLPLLFETGVLMDF-----------IVCVTCDSDKQLERLIARNELSESEARHRVDSQMPLDKKCEKSH---FVIDNNGSVEEAESSAMSIYNL...................................................................................................... 195
71 -9.320[R] KOG2878 Predicted kinase  ali follow..  15  25.PFILISGPQGSGKSTLASALDTELTRKNESVVKFS-----------------DDFYLTHAEQVELAKNNPNNPLVQHRGLAGTHDVTFLNNVLNA......................................................................................................................................................................................... 104
72 -9.240[J] COG0324 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  10  4.TAIFLMGPTASGKTDLAIQLRSQLPVEVISVDSALIYKGMDIGTAKPSKEELALASESYSAMNFRDDALREMADITAQGKILLVGGTMLYENIRAELEQKAAQQGWAAL-------HTELAKIDPISAARINPSDSQRINRALEVFYITGKSLTELTEEKGEALPYDFVQFAIAPQDRHVLHERIEQRFHKMIELGFQAEVEKLYARCVGYRQMWEYLQGDYAYEEMIFRGICATRQLAKRQLTWLRGWKTPIQWLDSLQPQQAKETVLRHLDSYQKG.. 311
73 -9.230[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  14  33.AKVMIIGDVDTGKTTLTIYLANELLSRGFRVAIIDSDISLAFVDSHFTSLD-GTITPNQYFGEMVVGVMKLSELAMKFSDVVLIDTTGMIYGSGVELKRMKIEAVKPNLILALERNNEL................................................................................................................................................................. 171
74 -9.210[R] COG0218 Predicted GTPase  ali follow..  15  25LPEIALAGRSNVGKSSFINTMLNRKNARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKAD.................................................................................................................................................................... 147
75 -9.210[R] COG1084 Predicted GTPase  ali follow..  11  162AFTVVIAGFPNVGKSTLLRTLTGAEPEVADYPFTTKGIQIGHLRKWKRIQVIDTPGLLDRPVEDMNNIELQAMVALENIADVIIFDASETCGYTLESQYSLYLG................................................................................................................................................................................. 268

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.