current user: public

If you have questions about the server, please let us know.

Query: [S] COG4121 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MFIMSSISHAQLGWNDAGTPVSDQFDDVYFSNVNGLAETRYVFLEQNHLPQRWHNDDQRRFVIAETGFGTGLNFLAVWQAFVAFREANPDAKLKELHFISFEKYPLSKSDLIQAHQAWPELAQFAQKLHKHYPLAIPECQRIVLNDGLVTLDLWFGDIKDCLPKVATQEQGLVDAWFLDGFAPSKNPEMWNQNLFAGMAKLAKHGCTCATFTSAGFVRRGLIDAGFAMKKVKGFGTKREMIAGSLSEKVPYTNIAPEFRFEATHGLQEVAIIGGGIASATLATTLALast
1 -117.000[S] COG4121 Uncharacterized conserved protein  ali  100  1MFIMSSISHAQLGWNDAGTPVSDQFDDVYFSNVNGLAETRYVFLEQNHLPQRWHNDDQRRFVIAETGFGTGLNFLAVWQAFVAFREANPDAKLKELHFISFEKYPLSKSDLIQAHQAWPELAQFAQKLHKHYPLAIPECQRIVLNDGLVTLDLWFGDIKDCLPKVATQEQGLVDAWFLDGFAPSKNPEMWNQNLFAGMAKLAKHGCTCATFTSAGFVRRGLIDAGFAMKKVKGFGTKREMIAGSLSEKVPYTNIAPEFRFEATHGLQEVAIIGGGIASATLATTLA 286
2 -12.300[R] COG2521 Predicted archaeal methyltransferase  ali follow..  15  120.....................................................RKVERAWGRVFECCTGLGYTAIEALK-----------KGARHVITVEVD------PHVLTLASLNPYSRGLWSP----------------------AVDVILGDCYAFVQTVR---DSSIDFIIHDPPRLSHATQLYSEALYREFYRILKRGGGVFHYVSQSGVAERLRRVGFAVEKIKGIYARRR............................................... 278
3 -10.400[R] KOG2361 Predicted methyltransferase  ali follow..  36LREEEPERLTSTNTDKYERDAKKYWDIFYKHHGDRFFKDRHYLDK----EWNSYFSVSGKSVILEVGCGAGNTIFPLIA------------TYPDIFVYACD---FSPRAVELVKAHDEYTETRVCAF----------------------ACDLTGDGLDK-------SPSSVDIVTMIFVLSAVSPE--MSSVLQNIRKVLKPNGCIAFYFSNEFLETLFSEQGFEVNRSRELVMNRRWVQATFRRTNGNKNPCDSLTPAKLDKSEQ.................. 301
4 -9.220[I] COG3963 Phospholipid N-methyltransferase  ali follow..  15  55.............................................................PVLELGPGTGV---ITKAILARGIKPE--------SLTAIEYST-----------------DFYNQLLRSYP----------------GVNFVNGDAFDLDATLGEHKGQMFDSV-ISAVPMLNFPMAARIKLLDELLKRVPHGRPVVQISYGPISPIVAQPHLYHIRHFD...................................................... 180
5 -8.990[R] KOG3115 Methyltransferase-like protein  ali follow..  12  1MSATAKKSAAQLQREEEEARKKLKRLSKQGGVEGRLPMKRLF-MDWSPYYPDFDVESNKKVEIVDIGCGYG-GLTVAL-----------GPQFPDTLVLGMEIRMQVSDYLKEKIQALRYRADHEEPV----------------PGGYKNISVLRMNCQKFLPNFFEKGQSKMFFCFPDPHFKARKHKIITSTLASEYAYFIRPHGTLYTITDVEELHVWMAQH.............................................................. 220
6 -7.970[R] KOG2940 Predicted methyltransferase  ali follow..  11  65.............................RDRAAWLSRQKNDSFVADNLLDRLEDCKKSFPTAFCLGGSLGMDTSYDMIKSCRDAQDDSLDNSIETSYFDEEFLPVKESSVDLI------ISSLGLHWTNDLPGSMIQCKLALKPDGLFLAAILGGETLKELRIACTLAHMEREG----GISPRLSPLAQVRDAGNLLTRAVDVDEYVVKYKRAMDLIEHLRAMG............................................................. 278
7 -7.860[R] COG0220 Predicted S-adenosylmethionine-dependent methyltransferase  ali follow..  17  36........................................................GNDHPIHIEVGCGKG-AFITGMA-----------ALHPEINYIAIDMQLSVLSYALDKAI----------------------------EADLPNVQMMLVDGAALSEYFADGEIDQVYLNFSDPWPKGRHEKLTYKSFLATYEKILRPEGEIHFKTLFEYSLVSLANYGMELKKV....................................................... 176
8 -7.280[Q] KOG1663 O-methyltransferase  ali follow..  14  94.............................................................NTMEIGVYTGYSLLATALALPEDG-----------KILAMDVNRENYELGLPIIEKAGVAH---------------------------KIDFREGPALPVLDEIVADNHGTYDFIFVDADKDN-------INYHKRLIDLVKIGGVIGY--------DNTLWNGSVVAPPDAPMRKYVRYYRDFVLELNK------ALAADPRIEICMLPVGDGIT......... 253
9 -7.160[E] COG0421 Spermidine synthase  ali follow..  14  30LKVKKVLYAGKSKYQDVLVFESETYGHVLVLDGAIQATERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVL------------------REVVKHECVEEAILCDIDEDVIKVSKQYLPEMSAGFNHP------------------KVKVHIGDGFKFLQD----YQNTFDVIITDSSDPGPAEALFQKPYFQLLSDALRGGGVITTQAECMWIHLGV................................................................. 211
10 -7.090[R] KOG2960 Protein involved in thiamine biosynthesis and DNA damage tolerance  ali follow..  14  9.....................................................................................................................................................................................TPQTAFKT-PVEKTAHNTVVKSEMGALSKAYPTYSLDESFSFAPIRESTV-----SRAMTRRYFSD--------------DKYAESDIVIVGAGSAGLTAAYYIG 96

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.