current user: public

If you have questions about the server, please let us know.

Query: [R] COG4134 ABC-type uncharacterized transport system, periplasmic component, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MMRHCGWLLGLLSLFSLATHASDWQEIKNEAKGQTVWFNAWGGDTAINRYLDWVSGEMKTHYAINLKIVRLADAADAVKRIQTEAAAGRKTGGSVDLLWVNGENFRTLKEANLLQTDWAETLPNWRYVDTQLPVREDFSVPTEGAESPWGGAQLTFIARRDVTPQPPQTPQALLEFAKANPGTVTYPRPPDFTGTAFLEQLLIMLTPDPAALNEAPNDATFARVTAPLWQYLDALHPYLWREGKDFPPSPARMDALLKAGTFRLSLTFNPAHAQQKIASGDLPASSYSFGFREGMIGNVHFVTIPANANASAAXKVVANFLLSPDAQLRKADPAVWGDPSVLDPQKLPDGQRETLQSRMPQDLPPVLAEPHAGWVNALEQEWLHRYGTHLast
1 -116.000[R] COG4134 ABC-type uncharacterized transport system, periplasmic component  ali  100  1MMRHCGWLLGLLSLFSLATHASDWQEIKNEAKGQTVWFNAWGGDTAINRYLDWVSGEMKTHYAINLKIVRLADAADAVKRIQTEAAAGRKTGGSVDLLWVNGENFRTLKEANLLQTDWAETLPNWRYVDTQLPVREDFSVPTEGAESPWGGAQLTFIARRDVTPQPPQTPQALLEFAKANPGTVTYPRPPDFTGTAFLEQLLIMLTPDPAALNEAPNDATFARVTAPLWQYLDALHPYLWREGKDFPPSPARMDALLKAGTFRLSLTFNPAHAQQKIASGDLPASSYSFGFREGMIGNVHFVTIPANANASAAXKVVANFLLSPDAQLRKADPAVWGDPSVLDPQKLPDGQRETLQSRMPQDLPPVLAEPHAGWVNALEQEWLHRYGTH 389
2 -60.800[H] COG4143 ABC-type thiamine transport system, periplasmic component  ali follow..  14  1MLKKYLPLLLLCA--------------APAFAKPVLTVYTYDSFAADWGPGPAVKKAFEADCNCELKLVALEDGVSLLNRLRMEG-----KNSKADVVLLDNNLLEAATQTKLFAKSGVANEAVKVPG-----------GWKNDTFVPFDYGYFAFVYDKSKLKNPPKSLKELVE--SDQKWRVIYQDPTSTPGLGLLLWMRKVYG-------------------DNAPQAWQKLAAKT----VTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHIIEEK--KDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM--YPVADVALPAGFESLAKPATTLEFTPQQVAAQRQAWI----SEWQRAVSR. 327
3 -56.000[E] COG0687 Spermidine/putrescine-binding periplasmic protein  ali follow..  13  1MMKRFGKTLLALTLAGSVAGMA------QAADNKVLHVYNWSDYIA-----PDTLEKFTKETGIKVVYDVYDSNEVLEAKLLA-------GKSGYDVVVPSNSFLAKQIKAGVYQKLDKSKLPNWKNLNKDLMHTLEVSDPGNEHAIPYMWGTIGIGYNPDKVKAPVDSWDLV--FKPENIQKLK-------QCGVSFLDSPTEILPAALHYLGYKPDTDNPKELKAAEELFLKIRPYVTYF------HSSKYISDLANGNICVAIGYSGDIAKSRAEEAKNKVTVKYNIPKEGAGSFFDMVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDPGIYPSEEVMKKLPDLPAKTQRAMTRSWTKIKSGK 367
4 -47.700[P] COG1840 ABC-type Fe3+ transport system, periplasmic component  ali follow..  14  16MEEIMRLTIISSLLLAGTTLLGV-----PAHAAGDLNLIC----AADVVICEQMKGDFEKTHDIKVNMVR-MSSGEAYAKIRAEA-----RNPKTDLWWAGTDPHLQAASENLTLEYKSKMLDQLQ------DWAKNQAESAGYKTVGVYAGALGWGYNTDIFKKEPKCWADLLA--PELKGEIQIANPNSSGTAYTALASLVQIMGE-----------------DQAFDYLKKLNGNI----SQYTKSGSAPVKAAARGETAVGIVFMHDAVAQTAEG----FPVKSVAPCEGTGYEIGSMSIVKGARNLENAKTWYDWALQPDVQSRMKDAKSF-QLPSNKTAEIPKEAPRFEDIKLINYDFKTYGDPEKR--KALLERWDKDVGAA 358
5 -33.900[P] COG1613 ABC-type sulfate transport system, periplasmic component  ali follow..  1MSSNSLAGIVKLALVVGSLQLGS---IGLALADTTILNVSYDP---TRELYKEFNAAFAEKWTVTIQTSHGGS---------GKQARSVIDGLEADVVTLALEDIDAIAKESGKIPADWK--------------------SRFENNSAPYTSTIVFLVRKGNPKA-IKDWGDLVR--EDVQVITPNPKTSGGARWNFLAAWAWARAANNGD--------------AKAQEYVAQLFKHVPVLDT---GARGATTTFVQRGLGDVLLAWENEAYLSLEELG--PDNFDIVTPSISIKAEALVDGNVDSKGTRKVAEAYLDYLYSDVGQKIAAK---HYYRPFKPELADPKDTAR.................................... 304
6 -31.500[G] COG2182 Maltose-binding periplasmic proteins/domains  ali follow..  12  1MKIKTGARILALSALTTMMFSAS-----ALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDK---LEEKFPQVAATGDGP----DIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVR---YNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKLMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADT---DYSIAEAAFNKGETAMTI--NGPWAWSNIDTSKVNYGVTVLPTFKGPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDK-SYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVD 384
7 -28.900[G] COG1653 ABC-type sugar transport system, periplasmic component  ali follow..  1MFNNSIHKVSICIALTLTFSA---------NAMAVTEIPFWHSEGELGKEVDSIADRFNQSQDYKIVPVYKGNYEQSLAAGIAAFRSGKAP----AILQVYEVGTATMMASKAIKPVYQ----DESVFVPTVAGYYTDSKTGRLLSQPFNSSTPVLYYNKEAFKKPPKTWQELAADTAKLRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGFDGTDAVLEPLQVKHIQLLSDMNKKGDFTYFGRKDESTSKFYNGDCAITTASSGSLASIRHYAKMMPYDADAKNAPQNAIIGGASLWVMDGKDTYKGVAEFLQYLVKPEIAAEWHQKT--GYLPITTAAYELTKQQGFYEQNP.............................. 369
8 -24.100[P] COG4150 ABC-type sulfate transport system, periplasmic component  ali follow..  10  6VKKNARNGLTHIALFSALILSG------VTASATELLNSSYDV---SRELFTALNPGFQAQWKLTIKQSHAGSS---------KQALAILQGLKADVVTYNQTDVQILHDRGNLIPADWQARLPNNSS--------------------PFYSTMAFLVRKGN-PKNIRNWDDLVR-------KLVFPNPKTSGNGRYTYLAAWGAT-------------ADGGDEAKTRDWMKRFLKNVEVFDT---GGRGATTTFVERGLGDVLISFESEVNNIRKEYGS--DQYEVIVPPVDILAEFPVAWVVEKNGTEKAAKAYLNYLYSPPAQQVITRFNY---------RVYDKAAMEAAKSQFPDTKLFRVEDQFGSWPQVMSTHFTT..... 332
9 -19.600[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  11  5MKKTTFTLAAASLILVSYSAS--------SADDARIRLAT-TTSTYDSGLLDYLLPKFEQDTGYKVDVI-ATGTGKALKMG--------ENGDVDLVMTHAPKAEASFVEAGFGVL------------------------------------PRKLMYNDFVVVGPESD-------------------PAKIADEKNIAKVFENIAKSGAVFISRGDDSGTHKKELGIWAQNK-----IEPNFGGYRSIGQGMGPTLNMASEMQAYTLTDRGTWLAYNNKL---ALKILFEGDEQLFNPYQVIIVNPTTQYHAAKVFSDWLVNPKGQQLINE......................................................... 259
10 -18.400[R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain  ali follow..  1MKKIITLFGACAL--------------AFSMANADVNLYGPGG---PHTALKDIANKYSEKTGVKVN-VNFGPQATWFEKAKKDA----------DILFGASDQSALAIASDFGKDFNVSKI------------------------KPLYFREAIILTQKGNPLK--KGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQD----------------------IKTIQNFRNNIV----AFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRT--------FNVIAKEGASKETQDFIAYLSSKEAKEIFKK......................................................... 245
11 -14.800[P] COG0725 ABC-type molybdate transport system, periplasmic component  ali follow..  13  1MAHSWLRLVAGATLSFVIAGH-------ALADEGKITVFA---AASLTNAMQDIAAEYKKEKNVDVV-SSFASSSTLARQI--------EAGAPADLFIADQKWMDYAADKKAVDTTTRETL----------------------------LGNSLVVVAPKASEQKPFTIDNKTDWIRLLNGRLAVGDPQHVPAGIYAKEALQKL------------------------GAWQTLEPKL-----APGEDVRGALALVERNEAPLGIVYGSDAVASKGVN------VVATFPEDSHKKVEYPIAIVEGHKNAT-VSAFYDYLKGPQASAIFKR......................................................... 251
12 -14.600[P] COG3221 ABC-type phosphate/phosphonate transport system, periplasmic component  ali follow..  2ISRRSALVIAAGLSALALASCSGKSDAPAANNEVTFSILSTESTQNMESYWTPILKDMEKQTGLKVKPFFSSNYSSLIVAMGA---------KQTDLGWFSNQSGLEAVRRSNGEVFARTFDPSGTD-----------------------------GYKSVIIVPADSKIQSVQDLLKCDKSLFGIGDKKSTSGTLAPMTYVFIPANKKPET-----------------------------FKTVISANHQANLFAVANGKLDASTNNSTAIGLSKARGEGVTDKIRVIWESP-----PEDPLVWRKDIDPVVKEKLRQFFLT.................................................................. 256
13 -11.000[E] COG2113 ABC-type proline/glycine betaine transport systems, periplasmic components  ali follow..  12  1MLKQITAMTAGLLMTIGVAAAA------EPESCKTVRFSD---GWTDITSTTAVASTILEALGYAPQSKLLSIPVTYAS-----------KNKDIDVYL---GDWQPSMEADRKPFLEDKSIEVIGPNLTG--------------------AKYTFAVPKYVADAGVKDISDLQKFPDKFGRKIYGIEPGNNGNRMILDMINKGDFGLTGWELVESSEQGM-----------------------------AEVERATKDDQWIVFLGWAPHPMNTRYQIDYLSGADAYFGPNYGGADIYTNIRAGYAQECPNVARFVTNLRFTLEMENEIMNG-------ILNDGNDPKDAAADWLKAHPEAV----------------APWLEGVTT. 296
14 -9.310[G] COG1879 ABC-type sugar transport system, periplasmic component  ali follow..  1MARHSIKMIALLTAFGLASAAM------TVQAAERIAFIPKLVGVGFFTSGGNGAQEAGKALGIDVTYDGPTEPSVSGQVQLVNNFVNQ----GYDAIIVSAVSPDGLCP--ALKRAMQRGVK-------------------------------ILTWDSDTKPECRSYYEMAAHQVDKEKAKVAFFYSSPTVTDQ-AKAKISQEHPGWEIVTTQFGYNDATKSLQTAEGIIKA--DAIIAPDANALPAAAQAAENLKRNNLAIVGFSTPNVMRPYVQRGTVKEFGLWDVVQQGKISVYVANALLKNMPMNVGDSLDIPGIGKVTVSP............................................................. 306
15 -9.160[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  13  1...........MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPA--KVAQADNTFAKESGATVDWRKFDSGASIVRALAS---------GDVQIGNLGSSPLAVAASQQV-----------------PIEVFLLASKLGNSEAL--------------VVKKTISKPEDL-------IGK-RIAVPFISTTHYSLLAALKHWGIKPGQV-------------------------------EIVNLQPPAIIAAWQRGDIDGAYVWAP-AVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDFAEKHPEVVKAFSKSAINPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAELTGPVNKAIIDTAQFLKEQ.... 300

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.