current user: public

If you have questions about the server, please let us know.

Query: [K] COG4190 Predicted transcriptional regulator, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MTESTPPLHPMEREQLRAESTLVVTVTPSSEFHDDITDSIAALEQGDAMDSTPTLSFTSYDDLMDTLTPRVLELIEAIRQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQRKRPVVWFDELVINLPFDPEAGDTAAAAPLast
1 -66.200[K] COG4190 Predicted transcriptional regulator  ali  100  1MTESTPPLHPMEREQLRAESTLVVTVTPSSEFHDDITDSIAALEQGDAMDSTPTLSFTSYDDLMDTLTPRVLELIEAIRQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQRKRPVVWFDELVINLPFDPEAGDTAAAAP 149
2 -23.400[K] COG1777 Predicted transcriptional regulators  ali follow..  12  7............................................................NFIAAIENSTRREIIRMLTQFERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPSS........................... 68
3 -22.300[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  11  15...........................................................VSIFHAADSEVKRKLLLDLS-TGWITLPVIEQKYG---KEGRRALLYLDKIKMIETQQNGPEKAYHTYYTNVQINIM............. 91
4 -20.400[K] COG4189 Predicted transcriptional regulator  ali follow..  17  14...........................................................FDVLKAAASLIRVQILKLLHEANGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLRTETRKARK........................... 76
5 -19.900[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  118YIKTRPGAYLSEIIEKAGIDAARYHIKILKA--HHKIEAYRESGKTRYFQNNSTYGEEEKKVVSALQNATNQRIISEIQNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDETRSGRSIIYSINPSYEPL................ 250
6 -19.700[K] COG2345 Predicted transcriptional regulator  ali follow..  11  5.........................................................VKGNDAHTGDGDTRRKILLILLERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPRQ............................. 67
7 -19.600[K] COG0640 Predicted transcriptional regulators  ali follow..  15  1.....................................................................................MNEITMQTQADQPKVSSNLAILSEARLVDSIQMGREKIYRIAPEKFEDMVD............. 51
8 -19.600[K] COG1497 Predicted transcriptional regulator  ali follow..  13  1...........................................................MKALRKKGELTRFQILSEIAMRQPVRQKDIADKLGVTVQAVSENIKSLIAEGLVE--SGSGRSHYKITRRGAE................. 72
9 -18.800[K] COG3355 Predicted transcriptional regulator  ali follow..  15  25..................................................................LSKSDVEVLHILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKE.......................... 81
10 -18.300[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  18  16..................................................................TLKRHISVINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSREG.............................. 68
11 -18.000[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  18  1..................................................................MKMKTLFLLIKLAKMGTVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRKGTLVELT...................... 67
12 -17.200[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  16  12.................................................................INDYDMLRVLKHFTIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNT.............................. 65
13 -16.700[K] COG4742 Predicted transcriptional regulator  ali follow..  2..........................................................QSELIDVVFSQKRRDLLLLLGE-EPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGS.............................. 62
14 -16.000[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  11  9.....................................................................RRLYLALLVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDG............................. 59
15 -15.200[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  21  16...................................................................SELRRKVLFYLLSIYPSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKNGFK.......................... 83
16 -14.600[K] COG1846 Transcriptional regulators  ali follow..  22  40..................................................................LTPSEIHTIDAIGTDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVSR.......................... 96
17 -14.400[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  14  19..................................................................LKKNEIRIYRLLEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQS............................. 73
18 -13.700[K] COG3432 Predicted transcriptional regulator  ali follow..  14  35.....................................................................GTMEIMFDILREPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRKIYEITEKGKLL................ 100
19 -13.400[KG] COG1349 Transcriptional regulators of sugar metabolism  ali follow..  18  2.................................................................KPRQRQAAILEHLQKQGKCSVEELAQYFDTTGTTIRKDLVILENAGTVIRTYGG.............................. 55
20 -13.300[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  14  81..................................................................LSPIEILILHSIRHRREKKLADICLALDIDTHIATYAIRKLEKAGLLTTGKAAKEKTVKIT...................... 143
21 -13.200[K] COG4738 Predicted transcriptional regulator  ali follow..  11  26...........................................................VELLRRLINRPVALTLACLSKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNH........................... 89
22 -13.000[K] COG1414 Transcriptional regulator  ali follow..  16  18....................................................................DKGLDILELLASVDGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDR---YSLTLKLFGLAQLHAPVRRLASFATP 96
23 -12.700[K] COG1522 Transcriptional regulators  ali follow..  18  6..................................................................LDKIDRKILEVLQSNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIR................................... 53
24 -12.500[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  20  237.........................................................ETAALNRIPLSPELCEVLDIIRGHGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLRNGRENILVLVDEE................... 310
25 -12.300[K] COG1510 Predicted transcriptional regulators  ali follow..  12  29..................................................................MPSTVGRVLGIIMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKEKGVRKDLYDVEQD.................... 94
26 -12.200[K] COG1654 Biotin operon repressor  ali follow..  18  4...................................................................TTVPLTLISLLADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGVDVFTVPGK............................. 56
27 -12.100[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  10  116.......................................VRGRRSAVSAQPGTLGDGLHSDGPRNPFTPKRAQVVCVLLDAPQLPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSRRR............................ 200
28 -11.900[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  13...........................................................LNELVGRAAGEVGLILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLADYVRRRDDE........................... 75
29 -11.300[K] COG3682 Predicted transcriptional regulator  ali follow..  20  3..................................................................ITAAEAHVMEALWRRSPLSADELVAEVGAAEATVKTLINRLLKKKAIKSERAEGKHGYRPLVDR................... 70
30 -10.600[S] COG2469 Uncharacterized conserved protein  ali follow..  10  197..................................................................LSEVEEQILTMVYTG--VDSVSVESILGVTTEELNKMYDRLVNLGLARVVKIRKEIELTPRGVALVSEI.............. 263
31 -10.500[K] COG1695 Predicted transcriptional regulators  ali follow..  13  1..................................................................MDRYAIKALVLLSKKLYQMSKEISTGVQVSHGTLMPMIRKLLQERYIDFETRGREKVYHLT...................... 64
32 -10.300[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali follow..  18  6..................................................................LTKNQSLVMGALHSDGPMSAYTILDKLRDNGFQVYRALDKLLEYGLVHR.................................. 59
33 -10.100[KT] COG1974 SOS-response transcriptional repressors (RecA-mediated autopeptidases)  ali follow..  20  4..................................................................LTEAQQELYEWLAEY-SPSIRQMMQAMNKSPAPIQSRLEHLRTKGYIEWTEGKARTIRVLQPIKQGVPV.............. 78
34 -9.960[K] COG1378 Predicted transcriptional regulators  ali follow..  14  28............................................................EVLKRLFRDYEARVYATLATRGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETIKSSPAVFRAIDPESVLEEYK............. 104
35 -9.780[K] COG2378 Predicted transcriptional regulator  ali follow..  19  23...................................................................ASRLFEIIQILRARRPVTAQTIADMLEVTARSVYRDIAALQTMRVPIEGERG.............................. 75
36 -9.680[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  21  1..............................................................MVLMHTDRIEEYLETIKNQGPAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKP................................ 60
37 -9.610[K] COG5340 Predicted transcriptional regulator  ali follow..  20  8............................................................QTIRQGLSTRESRLLSHLAAEG--SIDDVEATLEVAPNTAREIASRLTEKGWLDRLLPG.............................. 68
38 -9.380[C] COG1145 Ferredoxin  ali follow..  1.......................MHHSHHLEIYEKLREKLNKAPIGLPKTVSGVE----KELLSVLFDEEEAKIAVHM-PFIRFTAEQLAERTGKSLEYVEKILNEMAKKGTVWKGEKDGQTYYRLF...................... 99
39 -9.050[K] COG3888 Predicted transcriptional regulator  ali follow..  19  2....................................................................SLRDVLLRELKRARGLGIFQIEEMMGFSKSTVSEALKDLEEKGIIKRRTIG.............................. 54

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.