current user: public

If you have questions about the server, please let us know.

Query: [S] COG4519 Uncharacterized protein conserved in bacteria, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MELSPVFARRLYLALLVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDGRRHNDGYYQLSDWGPFDSQWVTERKKDIAASLGFCALast
1 -42.000[S] COG4519 Uncharacterized protein conserved in bacteria  ali  100  1MELSPVFARRLYLALLVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDGRRHNDGYYQLSDWGPFDSQWVTERKKDIAASLGFCA 95
2 -19.800[K] COG1414 Transcriptional regulator  ali follow..  13..RAPALDKGLDILELLASVDGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDRYSLTLKLFGL-AQLHAPVRRLASFATPFMRELADRS 105
3 -17.400[K] COG2378 Predicted transcriptional regulator  ali follow..  17MYNMRKASRLFEIIQILRARRPVTAQTIADMLEVTARSVYRDIAALQTMRVPIEGERGVGYILRPGFNL.......................... 86
4 -17.000[K] COG3355 Predicted transcriptional regulator  ali follow..  30..........VEVLHILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKE................................. 81
5 -16.000[K] COG4190 Predicted transcriptional regulator  ali follow..  11  70........RVLELIEAIRQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQ.................................... 120
6 -15.600[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  13  12.NDMDTLKRHISVINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSREGA.................................... 69
7 -15.400[K] COG1654 Biotin operon repressor  ali follow..  20  1...MKDTTVPLTLISLLADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGVDVFTVPGKGYS................................. 59
8 -15.300[K] COG4742 Predicted transcriptional regulator  ali follow..  15  6IDVVFRSQKRRDLLLLLGE-EPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGS--------YELTDMGEQVFKKARALVDVL........ 83
9 -15.100[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  13  1MKQEEMLKKLEDLLKLVEKRRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQS.................................... 73
10 -15.000[K] COG2345 Predicted transcriptional regulator  ali follow..  20...........KILLILLERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPRQ.................................... 67
11 -14.800[K] COG1846 Transcriptional regulators  ali follow..  10  45..........IHTIDAIGTDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVSRGI-QVVLTDKGREAYRAHADMHAAFYEEL.... 124
12 -14.300[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  10  1MSEYEK-YDMLRVLKHFTIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNTS.................................... 66
13 -14.000[K] COG4738 Predicted transcriptional regulator  ali follow..  29LRRLNINRPVALTLACLSKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNHGKGRPVKLYKLTVQMETIIDTIEENVIAESK... 120
14 -13.800[KG] COG1349 Transcriptional regulators of sugar metabolism  ali follow..  11  3.....PRQRQAAILEHLQKQGKCSVEELAQYFDTTGTTIRKDLVILENAGTVIRTYGGV.................................... 56
15 -13.700[K] COG1497 Predicted transcriptional regulator  ali follow..  10  4LRKKGELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVESGSGRSHYKIT............................... 67
16 -13.600[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  1MKMKTFLLIKLAKMGAIGKEITVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRKGT.................................. 62
17 -13.400[K] COG1777 Predicted transcriptional regulators  ali follow..  12  12..IENSTRR--EIIRMLTQFERSYALELSRSIGLSQQAILKQLEMLERANLV........................................... 59
18 -13.200[K] COG4189 Predicted transcriptional regulator  ali follow..  13  17LKAAASLIR-VQILKLLHEANGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLRTETRKARK.................................. 76
19 -12.400[K] COG1522 Transcriptional regulators  ali follow..  11  1MSKVELDKIDRKILEVLQSNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVI........................................... 52
20 -12.400[K] COG1510 Predicted transcriptional regulators  ali follow..  18  29..MPSTVGRVLGII--YMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEKGVRK................................. 86
21 -11.300[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  14  190...........RIISEIQNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDETRSG..................................... 236
22 -11.300[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  10  144...TPKRAQVVCVLLDAPQLVDAPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSR..................................... 198
23 -11.000[K] COG1959 Predicted transcriptional regulator  ali follow..  16  1MQLTSFTDRALIYMASLPEGRMTSISEVTDVYGVSRNHMVKIINQLSRAGYV-----TAVRGKNGGIRLG......................... 68
24 -10.900[K] COG0640 Predicted transcriptional regulators  ali follow..  1........................MNEITMQTQADQPKVSSNLAILSEARLVDSIQMGREK----IYRIAP----------EKFEDMVDWLDSIL 57
25 -10.800[K] COG3432 Predicted transcriptional regulator  ali follow..  32.RKRGTMEIMFDILRNCE--PKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDRK----IYEITEKG----KLLRTHIEEFIKIRE... 112
26 -10.800[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  10LRSLNRSELRRKVLFYLLSIYRSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQSKNGFK---YFKINPEIVEEVRNMKNMFSD......... 104
27 -10.600[K] COG2188 Transcriptional regulators  ali follow..  11  13EKVKDYILANIGTGRWGKDRKLPSENELVASLGVSRMTVHRALRELTAAGFLIRLQGVGTF.................................. 73
28 -10.500[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  17  11.ELLNELVGRALILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLA........................................... 66
29 -10.300[K] COG1695 Predicted transcriptional regulators  ali follow..  11  6..........IKALVLLSKKPRTLSKEISTGVQVSHGTLMPMIRKLLQERYIDFETRGREK----VYHLTERGSRFVESLGKIEEDVKQNL.... 85
30 -10.100[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  12  18FHAADSEVK-RKLLLDLST-GWITLPVIEQKYG---KEGRRALLYLDKIKMIETQWITGQNGPEKAYHT.......................... 81
31 -10.000[K] COG3711 Transcriptional antiterminator  ali follow..  12  3.......GDNQQILREIVLNPTIHGKELESIFGLSRRQLGYRIQKINL............................................... 43
32 -9.930[K] COG1321 Mn-dependent transcriptional regulator  ali follow..  12  3LMHTDRIEEYLETILYLITKNQAKTKQIAEELNVSSPSVTEMIKKLHSMGFVEYKPYQG-------VELTEKGAEEAVRIKRKHQ-LADVLDFD. 95
33 -9.740[K] KOG2593 Transcription initiation factor IIE, alpha subunit  ali follow..  31........IAVLVLDALTRRQWVREEDLAKELKLNTKQLRTILRYFEEQQFIMRVHRK..................................... 80
34 -9.710[K] COG1378 Predicted transcriptional regulators  ali follow..  30LKRLGFRDYEARVYATLATRGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETIKSS..................................... 87
35 -9.700[K] COG1725 Predicted transcriptional regulators  ali follow..  11  13SQISDWMKKQMITGEWKGEDKLPSVREMGVKLAVNPNTVSRAYQELERAGYIYAKRGMGSF.................................. 73
36 -9.460[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  86..........ILILHSIRHRDREKLADICLALDIDTHIATYAIRKLEKAGLLTTGKA----AKEKTVKITAKGAEACAHYAQIRERLLVDS.... 164
37 -9.240[T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  ali follow..  155IGRRTAIERAAYLIAFLYRK-PVTQQHVADTLGLSIVHTNKTLRKLVDRGLI........................................... 218
38 -9.240[K] COG4800 Predicted transcriptional regulator with an HTH domain  ali follow..  16  1MNVADKVIKSATLSAVIKEDLNLTAVDFAKKANIPPSTLYKIIKTLRQI.............................................. 66
39 -9.230[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  252...........EVLDIIGHKGRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRK......................................... 295
40 -9.230[K] COG3888 Predicted transcriptional regulator  ali follow..  22  1MSLRDVLLRELK-----ARGLGIDQFQIEEMMGFSKSTVSEALKDLEEKGIIKR......................................... 50
41 -9.220[K] COG2390 Transcriptional regulator, contains sigma factor-related N-terminal domain  ali follow..  13  1MGRINELRMISRVAQMYFSEH-KRQAEIAQHLNLSQATVSRMLKRAEAEGIV........................................... 51
42 -9.210[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali follow..  1MVTPQLTKNQSLVMGALHSDGPMSAYTILDKLRDNGFQVYRALDKLLEYGLVHR......................................... 59
43 -9.200[J] COG4901 Ribosomal protein S25  ali follow..  14  52...........AIAKEVQNMRVITPYEIASKYGIKMSVAFKVLRNLKERGDL........................................... 92
44 -9.150[R] COG1672 Predicted ATPase (AAA+ superfamily)  ali follow..  14  232REELEEPRNYFAIMEAVAA-GKTSLGEIMNETGLSRATVAKYLSVLIELDFVKREITASRKSRRGRYYIKD........................ 303
45 -9.150[S] COG2964 Uncharacterized protein conserved in bacteria  ali follow..  188.......AKNRQIVLNLYEKGKDAINQVADRLNISKHTVYLYIRQFKS............................................... 232

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.