current user: public

If you have questions about the server, please let us know.

Query: [R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRELast
1 -101.000[R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain  ali  100  1MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAIILTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYGWRE 250
2 -62.500[P] COG0725 ABC-type molybdate transport system, periplasmic component  ali follow..  16  1MAHGATLSFVIAGHALADEGKITVFAAASLTNAMQDIAAEYKKEKNVDVVSSFASSSTLARQIEAGAPDLFISADQKWMDYAADKK-AVDTTTRETLLGNSLVVVAPKASEQKPFTIDNKTD-RLLNGGRLAVGDPQHVPAGIYAKEALQ--KLGAWQTLEPKLA-PGEDVRGALALVERNEAPLGIVYGSDAVASKGVNVVATFPEHKKVEYPIAIVEGHKNAT-VSAFYDYLKGPQASAIFKRYGFT. 255
3 -56.500[P] COG4150 ABC-type sulfate transport system, periplasmic component  ali follow..  13  14LTHIALFSALILSGVTASATELLNSSYDVSRELFTALNPGFQAQDKLTIKQSHAGSSKQALAILQGLKDVVTYNQITDVQILHDRGNLIPADNNSSPFYSTMAFLVRKGNPKNIRNWDDLVREDVKLV----FPNPKTSGNGRYTYLAAWGATQDWMKRFLKNVVFDTGGRGATTTFVERGLGDVLISFESEVNNIRKEYEVIVPPVDILAEFPVAWVEKNGTEKAAKAYLNYLYSPPAQQVITRFNYR. 293
4 -49.200[P] COG1613 ABC-type sulfate transport system, periplasmic component  ali follow..  14  1MSSNSLAGIVKLAGLALADTTILNVSYDPTRELYKEFNAAFAEKETVTIQTSHGGSGKQARSVIDGLEDVVTLALEADIDAIAKESGKIPADNNSAPYTSTIVFLVRKGNPKAIKDWGDLVREDVQVI----TPNPKTSGGARWNFLAADAKAQEYVAQLFKHVVLDTGARGATTTFVQRGLGDVLLAWENEAYLSLEELGPDNFDAEPPVALVDGNVDSKGTRKVAEAYLDYLYSDVGQKIAAKHYYR. 290
5 -49.100[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  16  5MKKAASLILVSYSASSADDARIRLATTTSTYDSLDYLLPKFEQDTGYKVDVIATGTGKALKMGENGDDLVMTHAPKAEASFVEA------GVLPRKLMYNDFVVVGPESDPAKIADEKNIAKVFENIAKSGAVFISRGDDSGTHKKELGIWAQNKIEPNFGGYRSI-GQGMGPTLNMASEMQAYTLTDRGTWLAYNNKLALKILFEGDEQLFNPYQVIYPTTQYHAAKVFSDWLVNPKGQQLINEFKVN. 263
6 -34.500[H] COG4143 ABC-type thiamine transport system, periplasmic component  ali follow..  11  1MLKKYLPLLLLCAAPAFAKPVLTVYTYDSFAGPGPAVKKAFEADCNCELKVALEDGVSLLNRLRMEGKDVVLGLDNNLLEAATQTKLFAKSGVANPFDYGYFAFVYDKSKKNPPKSLKELVESDQKVIYQDPRTSTPGLGLLLWMRKVYGDNAPQAWQKLAAKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYHDNYAAANFSEGHYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWM. 281
7 -29.700[P] COG1840 ABC-type Fe3+ transport system, periplasmic component  ali follow..  13  16MEEIMRLTIISSLVPAHAAGDLNLICAAD-VVICEQMKGDFEKTHDIKVNMVRMSSGEAYAKIRAEARDLWWAGTGDPHLQAASENLTLEYKSKMLVYAGALGWGFKKKGYKEPKCWADLLAPELK---EIQIANPNSSGTASLVQIMGEDQAFDYLKKLNGNISQYTKSGSAPVKAAARGETAVGIVFMHDAVAQTAVKSVAPCEGTGYEIGSMSIVKGARNLENAKTWYDWALQPDVQSRMKDAK... 306
8 -18.500[R] COG4134 ABC-type uncharacterized transport system, periplasmic component  ali follow..  1MMRHCGWLLGLLSKNEAKGQTVWFNAWGGINRYLDWVSGEMKTHYAINLKVRLADAADAVKRIQTEADLLWVNGENFRTLKEANLLQTDWAETLSPWGGAQLTFIARRDVTPQ-QTPQALLEFAKANPGTVTYPRPPDFTGTAFLEQLLIMLTWQYLDALHPYLWDFPPSPARMDALLKAGTFRLSLTFNPAHAQQKIASGDLPASSYSFGFREVTIPANANASAAXKVVANFLLSPDAQLRKAD..... 332
9 -17.300[E] COG0687 Spermidine/putrescine-binding periplasmic protein  ali follow..  11  2MKRFGKTLLALTLAQAADNKVLHVYNWSDYIAP--DTLEKFTKETGIKVVYDYDSNEVLEAKLLAGKSGYVVVPSNSFLAKQIKAGVYQKLDKSK-IGYNPDKVKAAFGDNAPVDSWDLVFKPENIVSFLDSPTEILPAAL-HYLGYKPDTDNPKELKAAEELFLKIRPYVTKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPVAIPKDAENTEGALAFVNFLMKPEIMAEITDV.... 308
10 -15.900[P] COG1910 Periplasmic molybdate-binding protein/domain  ali follow..  15  80.......................NVMISGQDISMDILSKHLENAIQETPLRKYKGSLNSLIDMYQGK--LYDAETGQYNAPYVKRILTGEPFCLINVVLRKAGLYVQKGNPKNIQGWKDLKRADIRII-----NREKGSGARVLLDEQLGLLGVN--PADVVGYGDIVTDHYAAASQVSSGQADAGIGAQHAAHMGS--VDFIPLIDEQ-----YDIVVLKKNEQLLKAVKEILNSEDYKANLSHLGYE. 297
11 -13.100[P] COG4521 ABC-type taurine transport system, periplasmic component  ali follow..  13  4SSRNTLLAALAFIAFQAQAVNVTVYQTSAEPAKVAQADNTFAKESGATVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGNSEALVVKKT----ISKPEDLIGKRI--------AVPFISTTHYSLLAALKHWGIK-----PGQVEIVNLQPPAIIAAWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGPTLDVWVVRKDKHPEVVKAFSK.................. 226
12 -12.900[M] COG1732 Periplasmic glycine betaine/choline-binding (lipo)protein of an ABC-type transport system (osmoprotectant binding protein)  ali follow..  11  1MTIVSSLALLATVSLPLQAASPVTVGSKIDTEGLGNMILQVLESHGVKTVIQLGTTPVVRGAITAGELDIYPEYTGNGAFFFKDENDPAWKNAKQGFANNTWTIAIRQDEKNKLSSLADLSRYLKEGGTFKLAASAEFIERADALPAFEKAYDFTLNQNQLLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPKGVQPIYAPAPVVRESVLQAYPQIADWLQKKVAADYLRQKGWVK 305
13 -10.600[P] COG3221 ABC-type phosphate/phosphonate transport system, periplasmic component  ali follow..  12  3SRRSALVIAAGLSAAPAANNEVTF-STQNMESYWTPILKDMEKQTGLKVKPFFSSNSSLIVAMGAKQTDLGWFSNQSGLEAVRRSNGEVFARTFDP-DGYKSVIIVPADSK--IQSVQDLLKCD----LDFGIGDKKSTSGTLAPMTYVFIPANKKPETCFK--TVISANHQANLFAVANGKLDASTNNSTAIGLSKAR-KIRVIWESPTLPEDPLVWRKDIDPVVKEKLRQFFLTEQQRGYLKRLSIGG 279
14 -10.000[ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain  ali follow..  11  1MKKLVLSLSLVLAAAFAAIPQNIRIGTDPTYAPFEDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSS----LSITEKRQQEIAFTD--KLYAADSRLVVAKNSDI-QPTVESLKGKRV----------------GVLQGTTQETFGNEHWAPKGIEIVSY-QGQDNIYSDLTAGRIDAAFQFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEK..... 247
15 -9.610[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali follow..  10  50....DATASSPAKLDLGGNVSLTGAGASFPAPLYASWFTDLNKKPNLQINYQSVGSGAGVEQFIQGTVDFGASDVAMKDEEIQKVQRGVLL---LPVTAGGIVLAYNLPGVTKIKTWDALPSQPITVVYRDGSGTTGVFTKHLAAVSPEWKSKVGEGKSVSWPVGVGGKGNEGVTAQIKQTQGAIGYIEYGYAKQNNISYATLENKAGKFVKYPIVSFPDPVKAKAMEAAIEYALT-EGQKISGELGY.. 357
16 -9.550[G] COG2182 Maltose-binding periplasmic proteins/domains  ali follow..  1MKILTTMMFSASALAKIEEGKLVIWINGD--KGYNGLAEVGKKEKDTGIKVTVEHPDKLEEKFPQVGPDIIFWAHDRFGGYAQSGLLAEITPDKAPIAVEALSLIYNKD-PNPPKTWEEIPALDKELAFKYENGKYDIKDVGVDNAGAKAGLTF-LVDLIKNKHMNADTDYSIAEAAFNKGETAMTIN--SNIDTSKVNYGVTVLPTFK---LSAGINAASPNKELAKEFLENYLLTDEGLEAVN..... 320
17 -9.540[G] COG1653 ABC-type sugar transport system, periplasmic component  ali follow..  12  1MFNICIALTLTFSANAMAVTEIPFW-EGELGKEVDSIADRFNQQPDYKIVPVYKGNAAGIAAFRSGKAPAILQVYEVGTATMMASKAIKPVYSTPVLYYNKEAFLDPEQPPKTWQELAALRAAGSSCGYASGWQGWIQIENFSAWHGQPIASRNNGFDGTDAVLEFNKPLQVKHIQLLSDDESTSKFYNGDCAITTASSGSLASIRHYAKFNFGVGMMKDKETYKGVAEFLQYLVKPEIAAEWQKTGY.. 348
18 -9.500[P] COG1464 ABC-type metal ion transport system, periplasmic component/surface antigen  ali follow..  13  7MKFASTLILAGCGEKAVDNNKVKIVMAGAEAQVAEVAAKVAKEKYNLDVELTFTDYVTPNAALDDGSIDANAFQHKPYLDKQIA-------DRGYKLAIVGNTFVYPIA-SKQIKSVDEL-QDGARIAVPNDPTNLGRSQQGLLKLREDVGLLATVRDIVENPKKLEILELDAAQLPRSLDDVALSIIYASSINLTPEKDGIFVENKESPYVNILVAREANVNAENVQNFKKAYQTDEVAKAASE..... 265
19 -9.370[K] COG3888 Predicted transcriptional regulator  ali follow..  11  57....IKHVWLAEYYPYYDEKLLRICLRSTEYVKFVSVAKNYSESKGIDLIVRYDDAISLMNDLSQGLLEFALAPIFTEIIYSISNRNS-------------IILGAVASGGSGVYKNVNCNCGKI--------LTSESSSMMILAREFAKTRKI--------SEIAIFKDPRRAIKDYESFKAEYIVIWEPYASKIMGEKMASFSDVDSFPCCGISVSENNRENRTLIEIVRLYKREDVIDIFAKS.... 278

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.