current user: public

If you have questions about the server, please let us know.

Query: [S] COG4902 Uncharacterized protein conserved in archaea, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MRKKLIGFGLLALGIFSLVLQGVAAYRGTPGPSPVALAQVSYYAPLSDEEANSLLYMIEEEKLARDVYLKLYNETGLIIFDRIAQSEQRHMDAVLMLIEKYNLTAPDTLNEIGVFENEELQNLYNELVEMGSQSVVDALKVGALIEEIDIKDLEEWLSKVDNEDIKVVFENLMDGSKNHLRAFTKVLADNYGIEYTPLast
1 -79.600[S] COG4902 Uncharacterized protein conserved in archaea  ali  100  1MRKKLIGFGLLALGIFSLVLQGVAAYRGTPGPSPVALAQVSYYAPLSDEEANSLLYMIEEEKLARDVYLKLYNETGLIIFDRIAQSEQRHMDAVLMLIEKYNLTAPDTLNEIGVFENEELQNLYNELVEMGSQSVVDALKVGALIEEIDIKDLEEWLSKVDNEDIKVVFENLMDGSKNHLRAFTKVLADNYGIEYTP 197
2 -45.200[S] COG1633 Uncharacterized conserved protein  ali follow..  18  15..............................................LKGIEEAIALAIDREKEAREFYLQQAGLMEKELYEELAAEEMKHLGYLENYRDKKELPEISTEVPSGQSFSPEFDASRTK-VGEITLGDAGILLAAMRHERKSEDFYSEMAKRVEDETQKKFFEMLSRYERGHYEVIDSYLEYIT...... 162
3 -26.600[R] COG2406 Protein distantly related to bacterial ferritins  ali follow..  15  16..............................................VDKLLELLIKNAAAELTTYYYYTILRANLIKEIAEVARIEDRNHFEALVPRIYELGGKLPDCMKEFHDLSACPPARL------PDKPTVQEILRVLVAAERCAVKGYTEICNMTADHRTYELSLAILNEEIEHESWFSEFLGE........ 161
4 -24.300[P] COG3546 Mn-containing catalase  ali follow..  21  18..............................................NPGLANLLLEQFQGELAAACRYFSDDDAGRREMLMDIATEELSHLEIIGSLVGMLNKGAKGELAEGTENEAELYRSLTQNGNDSTIGEVTADLRSNIAAEARAKIIYERLINLTDDPGVKDTLSFLMTREVAHQLSFEKALYSIRN..... 197
5 -22.700[C] COG1592 Rubrerythrin  ali follow..  15  2................................................GTLENLVKAFIGESMARNRYTFYAKVAKDRVFLETAENEKEHAENLLKFIQQLRGDNAAIK--------------VEAEAPLVWGTTVENLKAAIEGEHEMYPQFADEAEKEGFKDIADRLRAIGKAEEHHERRYRRLLAEV....... 140
6 -22.600[P] COG2193 Bacterioferritin (cytochrome b1)  ali follow..  13  2............................................KGDTKVIERLNEALFLELGAVNQYWLHYRLLNAKKERAESIEEMQHADKIIDRIIFLEGHPNLQTLAP----------------LRIGQNVKEVLEADLAGEYDARTSYKKSCSEAGDYVSMKLFEALLIDEEGHIDFLETQLELLGKIG... 145
7 -18.400[S] COG3461 Uncharacterized conserved protein  ali follow..  13  13.................................................................................................................................TGKDRDFVRALNSLKEEIEAVAWYHQRVVTTKDETVRKILEHNRDEEMEHAAMLLEWLRRN....... 73
8 -16.900[S] COG2833 Uncharacterized protein conserved in bacteria  ali follow..  10  77............................................NTEHGRIALMHALAHIELNAIDLALDIVARFAVK-WMKVADDEARHFTLLRNRLKSLGAD-----------DMPAHDGLWQSAHQTRNDLEARLAVVPLILEARGLDVTPSLLEETGDHETAAILNIIYNDEKTHVAVGAKWFRFFCAR.... 227
9 -16.600[S] COG1814 Uncharacterized membrane protein  ali follow..  11  2..........................................ETTSNSKLVEVARKAALDEYKEYVTYSVLARVERRAVLERLAEQEREHFQFWNKFAGVKPPAWRFR-------------YAYFMAFLRLILGVTFVAKLMERGEEAIARYKSAEPLLSGPD--REALRRIIKDEEEHERALIAQLDE........ 138
10 -15.100[FJ] COG4445 Hydroxylase for synthesis of 2-methylthio-cis-ribozeatin in tRNA  ali follow..  10  94...............................................AFRQGPEPDFVALHKQISKSAMPQTDDPWGDRMVLLIKEELHHFWQVREVMQARNIP------YVKITASRYAKGMLKAVRTHEPLTLIDKLICGAYIEARSCERFAALAPWL-DEDLQTFYLSLLRSEARHYQDYLALAQQISAE.... 236
11 -15.000[P] COG1528 Ferritin-like protein  ali follow..  14  2.............................................LSQAIAEKLNEQINLEFYSSNVYLQMSAWCAHAFLLRHADEEMEHMQKLFNYVSETSGMPLLGK----------------EAPKNDYKTLKEIFEITLEHEKSKINELVEVTFAHKDYSTFNFLQWYVAEQHEEEMLFNSIIDKF....... 141
12 -14.500[S] COG3652 Predicted outer membrane protein  ali follow..  17MNRAISLPLKGAAWLLLVLALPFANAQDMNKTAPQTFVSEASAAGVAEIEAGKMALEKSTAADVKVF-------------KQMIDDHGKVNAELRSLAERKKLEVEDDASLTD-------KAKATLLDLRDASFDPAYANNQVAAHEKAVELFTQAADNLTDPELQAFAKTHLPALKHHLEMARALAKAHPSK.... 190
13 -13.800[S] COG3396 Uncharacterized conserved protein  ali follow..  10  24..........................................PDAYRKTLIRQIGQHAHSEIVGMLPEGNWITRARKAILLAKVQDEAGHGLYLYSAAETLGCARED------YQKMLDGRMKYSSIFNYPTLSWADIGVIGWLVDGAAIVNQVALCRTSYGP-YARAMVKICKEESFHQRQGFEACMAL....... 169
14 -13.700[H] COG2941 Ubiquinone biosynthesis protein COQ7  ali follow..  12  13.......................KSVSPFLRSSITCRRISMGRKELSEKDSNILDSVIRVELGANQIYKQFTDPKVAPTIQHMWDQEKYHLATFDNYVLKNRVRPTF--------------------AGTALLGTKAAMACTEAVETVIGGHYNDQLRETEFKEIRSHLAEFRDDELEHLN................ 181
15 -13.700[R] KOG4061 DMQ mono-oxygenase/Ubiquinone biosynthesis protein COQ7/CLK-1/CAT5  ali follow..  12  13.......................KSVSPFLRSSITCRRISMGRKELSEKDSNILDSVIRVELGANQIYKQFTDPKVAPTIQHMWDQEKYHLATFDNYVLKNRVRPTF--------------------AGTALLGTKAAMACTEAVETVIGGHYNDQLRETEFKEIRSHLAEFRDDELEHLN................ 181
16 -12.400[S] COG3685 Uncharacterized protein conserved in bacteria  ali follow..  10  2...........................................ATANEHLVAWLRDAHAMEEQAITMLTSQSSRLEKTRIDRHLQETKDQAAMLERCLERLDGGTSSIKDI----SGKIVAFGQGLSGLFVSDEVVKGTLASYTFEHMEIASYRILAEQAGDQETKRVCESILQQEIAMAEWLAQNAGEI....... 152
17 -11.900[M] COG5577 Spore coat protein  ali follow..  2............................................QLASHELHDLHELIVSCVNSITNMAMFRNMVQDQDLKNILNSHIQDYNMKVEFVKKAQGSNQKLNVPNLNVMLQN-FPPIAPRTDVQKMNDREIATAYLLTLKRAGREYAWSAMEMSNPEIRQFLKDAFTMSCNHAYDVWQWMVQKG--FYPL 163
18 -11.000[S] COG3544 Uncharacterized protein conserved in bacteria  ali follow..  10  90.....................................................IDAMIPHHQGAVKMANVAQQKSKRPEIKNLADAQNQEITQMKQWRTAWYPKAGDKPMAYDAKMGHMMEMSSEQMQAMMMDIDLGAINAMIPHHEAAVVMAKDALQKSQRPEIKNLAQEIIKAQDTEINQMKQWRKTWYNQ.... 242
19 -9.090[R] COG3687 Predicted metal-dependent hydrolase  ali follow..  12  133..........................................NEPMATHVLNVLHMLLPAEEFFVRVFKKTLPLIKDDQLRLFIGQEAMHSQAVVDHFDAQGVDVTAFTNQIRWLFEKLLGESPRRSPRRQYSWLLEQVSFIAAIEHYTAVMGEWILNSPQDPVMLDMLRWHGAEEVEHKAVAFDTMKHLRAGYW.. 299

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.