current user: public

If you have questions about the server, please let us know.

Query: [R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MNEQQLLENIASLAGAINQYKNEKAEPTQVLDAAKANKNTRSYPYSVSRNYSFILNKSNRSKSTAASPPYVIPSTSSNADDANKEPEKQSTSDYVSRKNRHMQLIKKNILEHDLQARKANLESYRAKLEKEYKTLAENKIQQRLSDGTKQLVTIDGLQYITGVSDTKWLEFVSAKGQCPKYLYWNNKSYLLKKKRFLKEVGNSPSAVYCRYYNANGICGKGAACRFVHEPTRKTICPKFLNGRCNKAEDCNLSHELDPRRIPACRYFLLGKCNNPNCRYVHIHYSENAPICFEFAKYGFCELGTSCKNQHILQCTDYAMFGSCNNPQCSLYHGAVSADVPEQTEAPISKTAGSINPEDSGSEIGSNSLESNLDFISVLast
1 -141.000[R] COG5084 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins  ali  100  1MNEQQLLENIASLAGAINQYKNEKAEPTQVLDAAKANKNTRSYPYSVSRNYSFILNKSNRSKSTAASPPYVIPSTSSNADDANKEPEKQSTSDYVSRKNRHMQLIKKNILEHDLQARKANLESYRAKLEKEYKTLAENKIQQRLSDGTKQLVTIDGLQYITGVSDTKWLEFVSAKGQCPKYLYWNNKSYLLKKKRFLKEVGNSPSAVYCRYYNANGICGKGAACRFVHEPTRKTICPKFLNGRCNKAEDCNLSHELDPRRIPACRYFLLGKCNNPNCRYVHIHYSENAPICFEFAKYGFCELGTSCKNQHILQCTDYAMFGSCNNPQCSLYHGAVSADVPEQTEAPISKTAGSINPEDSGSEIGSNSLESNLDFISV 377
2 -48.300[R] KOG1492 C3H1-type Zn-finger protein  ali follow..  18  10.......SLVWTQNDPQPRMPIAHMRNQNIVPKRVTYWRRLMNSVSAFRNGSSLNISRKLSMMRKRHTIYTRSTNGYSLRKSKVLSVGGSHLKWSKSIERDSRKANEEATLAVAAYSKKESEKQSGQNNTSTASRNHKFFIIDFWFSGERVFRFGSLRYKMDSSRRTLQRISDVDSRDPKKRTRVLANEKVRWSLHNARLRLAKKKKYCQFFTRFGKCNKDDKCPYVHDPSKIAVCTKFLNGLCANA-NCKLTHKVIPERMPDCSYYLQGLCNNEACPYRHVHVNPIAPICDGFLK-GYCSEGDEHS----YNCPVFEATGSCSGLKCKLHHPKNQSKGRKRKRTNEPSQKNARRRYFSSLHNILSESEPMVF.... 427
3 -36.900[K] KOG2494 C3H1-type Zn-finger protein  ali follow..  24  15......................................................................................................................................................................................................................................LTLEVCREFQRGTCSRADDCKFAHHVENGRVVACFDSLKGRCTRENCKYLHPPPHDKLEVCREFQR-GNCTRGEDCRYAHVTICMDYIK-GRCSREKCKYFHPPAHLQARLKAAHHQMNHSAASAMALQPGTLQLIPKRSALE.... 274
4 -29.200[S] KOG4791 Uncharacterized conserved protein  ali follow..  17  3..........................................................................................................................................................................................................................NQGEDCYF------------FFYSTCTKGDSCPFRHCEAALGNEVCTLWQEGRCFRRVCRFRHMEIDKK---------------------RSEIPCYWENQPTGCQKLNCVFHHNRGRYVDGLFLPPSKSVLPTVPESPEEEVKASQLSVQQNK..... 124
5 -21.400[R] COG5063 CCCH-type Zn-finger protein  ali follow..  13  144................................................................................................................................................................................................................................................ASFSSEKESSAQPKVKSQVQETPKQLY-------------------KTELCESFTLKGSCPYGSKCQFAHTKPCVNWEKLGYCPGRRCCFKHGDDNDIAVYVKAGTYCNVSSTSKQSDEKRSNGRGSAKKK...... 271
6 -20.000[O] KOG1039 Predicted E3 ubiquitin ligase  ali follow..  21  1.........................................................................................................................................................................................................MSTKQITCRYFMH-GVCREGSQCLFSHDSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAQLCPYAAAGECRGDACVYLHGEVASQDKVCRRFGILSNCNH--SCENPIIKSCPEFEQGGTCPGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHV.. 390
7 -18.700[R] KOG1595 CCCH-type Zn-finger protein  ali follow..  18  226.....................................................................................................................................................................................................................SRAYSHDWTECPFVHPGENARPCPEFRKGSCPKGDSCEYAHGVFESWL-------------------H----------PAQYRTRLCKDETGCARRV-----------------CFFAHRRDELRPVNASTGSAMVSPRSSNQSPEMSVMSPLTLGSSP..... 350
8 -18.000[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  1MEQKNL-----------NINQASGSKINTELAVPIFQSRRRHRPRQGLKRKKGFKRDDDSGGSSESSNEDMRDNIPIVSGRKKTVRLNRLQRESEQFENSALKDINVEYQSNLSATGESVNTTTVSAINEDTREVILGRPSPKLANQSTLPTEL---------QSQNDYSRFLPKRKDFEKKSQVGPVLSSNASTVRMNTIIDYQPDVCKDYKLTGYCGYGDTCKFLHMREDYK--------VC-----------------LICKKDYRS-----TC---HH----------------FCE---QC-YRKTPTCI------------CGADTKGLFSVDKNFDRLLKNRKSKNDEAVKQKVGGFESNNSATTE.... 336
9 -16.900[R] KOG1763 Uncharacterized conserved protein, contains CCCH-type Zn-finger  ali follow..  12  4.....................................................................................................................................KKQAQAGGSKKADEKKKEKIIEDKTFGLKNKKGAKQQKFIKAVTHQVKFGQQNPRQVAQSEAEKKLKKDDKKKDLQELNELFKPVVAAQKISKGADP-KSVVCAFFKQGQCTKGDKCKFSHDLTLERKCE----ARDEELEKDVNKKHGEAEKKKPVCKHFLKYGWCPGGDICMYRHALP-PGFV------------------KKDKKKEEKEDEISLEDLIERERSALGPNVTKITLESFLA. 257
10 -16.700[R] COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein  ali follow..  12  32..................................................................................................SKGSHSISKPLGFTHIKSQESYISKMPPKKGKQAQAAGKKKDNVDKTFGMKNKNRSTKVQKYIKQVQSQSDPKKEEMRLKKLEEKKRREAEEAERRALFNPVADQRVRAGVDP--------------------KSMVCALFKLGNCNKGAKCKFSHDLNVGRRMVCKYFI------------------EAVENGKYGWFWICPNG---------------------GDKCMYRHSLPEGFVLKTNEQKRLERESLEKQPKITLEE.............. 280
11 -16.400[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  12  1MSDSG---EPKPSQQEEPLPQPAAQETQSQQVCTFFKKPTKSKNIRKRTIDADEEDGDSKSESSILQNLKKVAKPDSKLYFSSGPSKSSTTTSGAPERSVFHYDSSKEIQVQNDSGATATLETETDFNQDARAIRERVLKKADEALKGNKKKASDEKLYKGIHGYTDHKAGFRREQTISSEKAGGSHGPLRASAHIRVSARFDYQPDICKDYKETGYCGYGDSCKFLHDRGDYK--RNKAMGVEDEDDEADKDSDEDENALPACF-----------C--REPFVDPVVTKCKHY----FCE---HCALKH--KCF------------CNQPTMGIFNAAHEIKKRMAEERSKAEQGLRRLWPVGEVVPKSK...... 357
12 -12.500[R] KOG3002 Zn finger protein  ali follow..  11  2..................................................................................................................................................................APGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLEC---------------PVCTNLMY-QCPNGHTCSSCKLRVQNTCPTC----RYELGNIRCLALEKVAESLEVPCR-YQNLG-CQD----KLKHEQHCRFRSYSCPYAGSECSVDHLKDDHK....................................... 170
13 -12.300[R] KOG4377 Zn-finger protein  ali follow..  100.RHESLAQPTLQPSEPLETNSSTNLSSTILDKVSVVRAAGTFYPENANSAAQGETPEVVSSRYNSRQESNDLEVDQPEDLSMRPSLPEATATPAVVGPALNMNLLQFKQLIDLYQRQVLLPSFLAAASQPLALPGSAAGPGVSGPLLDMRILLENAAQQKLMLLNAAASATASAVAATTINSGQRTAAKRNRDHDIPSGYLKFRFNEDCSHF----HCNR-RDCHYSHERMDTLMGDDFRQ---RANMQCGVASCGYATAS--C----------RKCDYVHRRLHLRQD-FRKVGGNEQCDS-PGCSYTH-YHC-----------VTCDGAHKHRTGFPKQEA.................................. 489
14 -11.900[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  10  651.EAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYN-----------IKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIAHNEEQMKGCFSEAYKLIQEDRHLVISLETTKWEVADADKEFRWLKSAVSSSEKEYEQISRRTDDIKLELDDEREKKKLEEELMELNKELEELGSESVEAAIVRLQEEVKNCKNILKC------------------------GVCFDRPKEVV----------------IVKC----------------HL----------------FCQ---QC-EIRHRKCP-----------GCG................................................ 886
15 -11.800[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  10  1MSQKNFFDE-GKSYGVNDYAGFHFENGADSSLPQVSAQGVVRETDSSNFDASPVASGSGISDVGPFGADFHQLQQHVQTPYGGMTMPASSSSGATSVPPEQDPSLSVSFNRLPKSASTKTKNGRIRSSRREDDNRIPFYDLDVAEGAEDDLQEDFHVEGMKTKSGRKIQR----------------VAYNPNATALKRKSRKVDMVTLCS------VCQRGHS----PLSNRIVFC-----------DGCNSPHQ--------------------LCPIDDATVQDVD----------FCMK---CQYR.................................................................... 246
16 -11.700[T] KOG3575 FOG: Hormone receptors  ali follow..  12  29....................................................................................................................................................................................................................................SKRPTENCK-----VC--GDRPNNDR------------YGASACLG----------------CTVFFRRAVCMKEQNCSCTYRNACRY------CRFQKCFAVGMHSSAIQRRDLVGPRKISGDGEVIICENNTFLDDFASFQR..... 140
17 -11.000[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  23  23........................................................................................................................................................................................................................................................EC-----------AVCYSEMILPTTIPSC---HK----------------FC----IC-VSNNGDCP------------CR................................................ 64
18 -11.000[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  15  33....................................................................................................................................................................................................................................DEDLEELCP-----VC--GDKVSGYH------------Y--GLLT---CE------------CKGFFKRTVCIENQNCDKTQRKRCPY------CRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRAN...... 143
19 -10.500[R] KOG4299 PHD Zn-finger protein  ali follow..  1MDAKPWNHTSEAFQASILEDLKIIQKAGAERNAKSSHGSINSRSASPNKATSRRNRAQNGNSNGRASVDNSDDGSKDDLDYSPSVKRKHVNGEGAEKGDHDTSNNGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSE----VTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYC----------SAC-------GPGNFLC--------C---ETCPNSH-FTCPPIEEKNLPDDA-CN................................................ 307
20 -10.400[S] KOG4149 Uncharacterized conserved protein  ali follow..  15  198...................................................................................................................................................................................................................................................................................DCP------------CLGGMAHGPCGE--SCSEPKGMECLDKFQA-----QACFQKHPEIYQDMVGESEEEDAETNEKPSTTSDENNQPQSPPSDNAS.... 288
21 -10.300[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  11  580.SVHLAMSQMGLLARLLKDLGTGSSGFTIDN-----------------------VMKFSVSALEHRVYEVRETAVRIILDMYRQHQASILEYLPPDDSNTRRNILYKTIFEGFAKIDGRATDAEMRARRKAATEEAEKQKKEEIKALQGQL----------AALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSHCLMLTRCDHCKQVVEISSLTEHLLTECDKKDKC-----------YRCS--LPRHIKHKDCN---AKPEKLANRCP------LCSPGEEAWKAHLM-----------GPAGCT-MNLRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKIPTPK...... 911
22 -10.300[T] KOG4296 Epithelin/granulin  ali follow..  12  103........................................................................................................................................................................................................................ECSDDETCCKLGDPMPNAVCCDDRSHCCPTGTTCDPQGARNQFNEVVCPDKASKCPDGSTC-----LLEQGSYGCCPVPNAVCCADMLHC-------CP--------NGFTC................................................. 224
23 -10.200[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  18...KDAMEQCHNYNARLCAERSVRLPSQTGVAQSNCYIWMEKRHRGPGLASGQLYSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKRGAPDPRVDDDSLGEFPVTNSRARKRILEPDDFLDDLDDEDYEEDTPKRRGKGKSKGKGVGSARKKLDASILEDRDKPYACDICGKRYKNRPNNYCDFCLGDSKINKKT------QPEELVSCS-----DCGRSPSCLQFTPVMMAAVKECK-----CCN---C--GTSENDDQLLFCDD------CDRG------HMY-CPSMSESWSC--HLCLDLLKEKASIYQNQNSS................................ 391
24 -10.100[S] KOG4376 Uncharacterized conserved protein  ali follow..  17  6....................................................................................................................................................................................................................................DESDMVYCPY--------------EHKMLRKKLQQCRVIYKDTVELMVCPFSHLIPEPQF-------------------FQHTQSCED............................................................. 68
25 -9.940[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  18  57..........................................................................................................................................................................................................KEAAPKCN------NCSQRG-----HLKKD---CPHIICSYCHYSRHCP--------KAIQCS----------KC---HYRSQ-----CPHKWKKVQCTL---CKSKHS-RCPSIWRAYILVDDNCG--H............................................. 172
26 -9.900[A] KOG2202 U2 snRNP splicing factor, small subunit, and related proteins  ali follow..  20  11...........................................................................................................................................................................................................................................................................................TEKDRVNCPFYFKIGACRHGDRCSRLHNR--PTISPT......................................................... 45
27 -9.540[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  43..DGDLKSVVERIRGTVTPIGVPLRSSLVPSVSGVLQIVKLHEHRVTRGFAGFWTEQHKLLHESANEMPFELRNQSHGVEIVDALSAAVLDVDVVYDNYEPSNLSLFDHVFGFFSGVRQRGLQTTEEVLREGSFLTAIGELELDGDTLRMQPSNEGPLFLTTATKSTLIKRFEDAKTTTIIAKKLYRKRKQEREEAKIRERLDTERRERRARSRPHTLSQDQLC---------VVC---------------STNPKEIILLP--------------C---H--------VC--------CE---DCAQKISVTCP------------CR................................................ 326
28 -9.430[R] KOG3555 Ca2+-binding proteoglycan Testican  ali follow..  15  338....................................................................................................................................................................................................................................................................IPLCD--EDGYYMPTQC---HGSV-------------GQC-----CVDRYGNEVMGSRINGV---ADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDEDEGDD.... 425
29 -9.310[K] KOG3815 Transcription factor Doublesex  ali follow..  16  24..................................................................................................................................................................................................................................................................QRTPKCA----------RCR-NH----------------GVLSKG------HKRYCR-FKD---CTCEKCILIIERQRVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGD..... 102
30 -9.240[W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases  ali follow..  15  501............................................................................................................................................................................................................GKRNCFQERTSAFCGNGEEC----DCGFSQADCDQMGDKC-GPGPCKRKPGAQ------CSPSQGYCCNPDTCSLH-----GKNEEKI--RQESECSNLQTCDGRNA-QCPVVCSSGQCNGSVCA................................................ 637
31 -9.230[R] KOG4602 Nanos and related proteins  ali follow..  18  227.....................................................................................................................................................................................................................................GGLGTLCNF-----CKHNGESR-SHQLKTPD---------GVVV---CPIL------RHYVCP------VC--GATGDQAHTLKCP--------GGQQSLYRRSGRNSAGRRVKR................................. 308
32 -9.180[R] KOG2333 Uncharacterized conserved protein  ali follow..  20  37................................................................................................................................................................................................................................EKIHVKENNALCPAISIGECPYKENCKFPHDVEA--------------------YLATKAPDIGDKCPIFERYGVCPAGFKCR---------WLAG-----------HVVINADGKYELIKKPDGQFTLFTVNTVGKEVQRKLRTKQLDL... 147
33 -9.130[K] KOG2857 Predicted MYND Zn-finger protein/hormone receptor interactor  ali follow..  16  1...............................................................................................................................................................................................................................................................MCPRATQTC-----EICEKVVSKYK-------------------CPS---CLVPY---C----------SLGCFKIHKVCNLINNAETPCAKPSDPSSTEEKPVVQCEPWFESCSGFV.... 78

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24