current user: public

If you have questions about the server, please let us know.

Query: [R] COG5258 GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .
# Score Template Links and tools%idFirst MFPPESEDGNVEYKLTLGPQDVDRMAGQLKRRLAEGGGEAVYLIGVSNDGRPLGLPDEELVKALETLREMARRVGASLYILRVSEGIRGKVAEVLLRAVSREEPPPTVTVVALGNVDAGKSTLVGVLTTGRLDDGKGLARSYASRYKHEVLTGRTSAVSLRLLGFSGDKVVNHGLIDPLDEAEVYKRSDKLVLLVDVGGHERYLRTALRGLFSSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRILKMPGVSKIPYIIKDTNDVVLAAKAMPAGRVAPVFYVSSVTGHGLDLLLRFLSLLPRRRRWDYGGEFLMYISDIYLVKGVGVVIGGLVEKGILHVGDRVWLGPYSDGKWMQTVVKSIHFNRTPVESAKAGSFITVALDKVEKVEKGMVLSARPLKAVREVTADVLVLRHPTVIRAGFSGVFHYKAVRTGGYIKEIDKGELMVGDSGVVKIELSRPWHIDSGVFVFRNGPTRILGRIIGTDGTLSALast
1 -140.000[R] COG5258 GTPase  ali  100  1MFPPESEDGNVEYKLTLGPQDVDRMAGQLKRRLAEGGGEAVYLIGVSNDGRPLGLPDEELVKALETLREMARRVGASLYILRVSEGIRGKVAEVLLRAVSREEPPPTVTVVALGNVDAGKSTLVGVLTTGRLDDGKGLARSYASRYKHEVLTGRTSAVSLRLLGFSGDKVVNHGLIDPLDEAEVYKRSDKLVLLVDVGGHERYLRTALRGLFSSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRILKMPGVSKIPYIIKDTNDVVLAAKAMPAGRVAPVFYVSSVTGHGLDLLLRFLSLLPRRRRWDYGGEFLMYISDIYLVKGVGVVIGGLVEKGILHVGDRVWLGPYSDGKWMQTVVKSIHFNRTPVESAKAGSFITVALDKVEKVEKGMVLSARPLKAVREVTADVLVLRHPTVIRAGFSGVFHYKAVRTGGYIKEIDKGELMVGDSGVVKIELSRPWHIDSGVFVFRNGPTRILGRIIGTDGTLSA 517
2 -73.900[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  18  1......................................................MNSAKATSLLFQGFRKNCLRLNRISFASGLINRFTVPARTYADEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQASFMDYIDKAPEEKARGITISSAHVEY----------------------ETANRHYAHVDCPGHADYIKNMITGAAT--MDGAIIVVSATDGQMPQTREHLLLARQVGVKIVVYINKVDMVEPDMIELVEMEMRELLSEYGFDGDNT-------PIVSGSALCALEGRE----PEIGLNSITKLMEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTVVTGRVERGTLKKGAEIEIVGY--GSHLKTTVTGIEMFKKQLDAAVAGDNCGLLLRSIKRERGMIVAQPGTVAPHQKFKASFYILTKETGFVDKYRPQLYSRTSDVTVELTHPDDKMVMPGDNVEMICTLIHPIVIEKGRFTVREGSTVGTALVTELL..... 438
3 -69.300[J] COG0050 GTPases - translation elongation factors  ali follow..  22  1...............................................................................................MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFIDNAPEEKARGITINTSHVEY----------------------DTPARHYAHVDCPGHADYVKNMITGAAQ--MDGAILVVAATDGPMPQTREHILLGRQVGVPIIVFMNKCDMVDEELLELVEMEVRELLSAYDFPG-----------------------DDLPVVRGSALKALEELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEVEIVGI--KDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKRERGQVLAKPGSIKPHTTFESEVYILSKDTPFFKGYRPQFYFRTTDVTGTIELPEGEMVMPGDNINMIVTLIHPIAMDDGRFAIREGRTVGAGVVAKVIA.... 394
4 -67.600[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  15  1..................................................................MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTV-----------RFKNELERNITIKLGYANAKIDPSCPRPECYRSCGSSMPD-FRLVRHVSFVDCPGHDILMATMLNGAAV--MDAALLLIAGNESCQPQTSEHLAAIEIMKLKILILQNKIDLVKERQAKEQYEQILAFVQGTVAEG-----------------------APIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKKGGVAGGSILKGVLKVGQETEVRPGIVSKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDDRMVGQILGAVGALEIFTELEISYFLLRRVQKLSKNEVLMVNIGSLSTGGRVS--------AVKADLGKIVLTNPVCTEVGKIALSRWRLIGWGQIRRGVTIKPT 468
5 -61.500[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  21  2......................................................................................................KNQSEINIGLVGHVDHGKTTLTKALSGVWTD-----------THSEETKRGISIRLGYADITFRKCPQCEAPMCYTTAEICEETELLRKVSFVDAPGHETLMATMLSGAAL--MDGAILVIAANEPCQPQTKEHLMALDVIGVKVIVVQNKIDIVSKERALESYREIKEFVKGTCAED-----------------------APIIPVSAQQGANIDILIETIEERIKTPKRDVDKPARMYVARSFDINKAGGVIGGSLVQGRLRVGDEIEIRPGIQVK-LHSTITGLVAGGEEMEEVGPGGLVGVGLTKADSLSGSVAGEPGTLPPVHSFTMETHLLERVEPIKTGEPLMINVGTTTTVGVVK--------SARADDADVVLKLPACAEEGRIALSRWRLIGYGII......... 407
6 -58.700[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  24  1...........................................................................................................MIIVTSGHVDHGKTALLKALTGTSTA-----------HLPEEKKRGMTIDLGYAYLPLENKV----------------------LGFIDVPGHEKFLSNMLAGLGG--VHYAMLIVAADEGVAVQTKEHLAILRQLQFHIIVVITKADRTNSAQIESLIQTIKQDYSFL-------------------------RNANYFVTSAETGQGISELRHYLANL--AELADTQKPFRYAIDRVFSVKGAGTVVTGTAFSGTVKVNDEIYLSTG-----QKIRIKAIHAQNTSSEQGIAGQRLALNLNA-PMKRGDWLLQNEPLPPTDRISVQILAEV---PLNESQPVHIYHGASRTTGKLTLLQGKNAAKNDRTLAEIILDSPLFLFGDKLILRSKTLIAGARVLEINSPKRH 349
7 -58.100[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  24  2..................................................................................................KIMASQKPHLNLITIGHVDHGKSTLVGRLLY----EHGEIPAHIIEEYRKEAEQKGKATFEFAWVMDRFKEERERGVTIDLAHRK-FETDKYYFTLIDAPGHRDFVKNMITGTS--QADAAILVISAREGVMEQTREHAFLARTLGVPQMVVINKMDATSEKRYNEVKADAEKLLRSIGFKDISFV---------PISGYKGDNVTK--PSPNMPWYKGPTLLQALDAF-KVPEKPINKPLRIPVEDVYSITGIGTVPVGRVETGVLKPGDKVIFLPADK----QGDVKSIEMHHEPLQQAEPGDNIGFNVRGIAKIKRGDVCGHTPPTVVKAFTAQIIVLNHPSVIAPGYKPVFHVHTAQVACRIDEIKPDFIKNGDVAIVKVIPDKPLVIEKGRFAVRDGQTVAAGQCIDLEKR... 427
8 -57.100[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  21  2.....................................................................................................GKEKVHINIVVIGHVDSGKSTTTGHLIY----KCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWK-FETAKYYITIIDAPGHRDFIKNMITGTS--QADCAVLVVACGTGEFGQTREHALLAQTLGVKQLIVCNKMDSTEEARFTEITNEVSGFIKKIGYNPKAV---------------------PFVPISGFNGDNMKTLLEALDSI-IPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQN----VTTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVIRRGSVCSQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNELFPKFLKSGDAGIVELIPTKPLCVESGRFAVRDRQTVAVGVIKSVEKSDGS 447
9 -53.900[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  18  1................................................................................MNTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLH----DTRQIYEDQLSSLHNDSKRHGTQGLDLALLVDGLQAEREQGITIDVAYRY-FSTEKRKFIIADTPGHEQYTRNMATGAS--TCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVINKMDLVSEETFTRIREDYLTFAGQLPGNLD----------------------IRFVPLSALEGDNVPTLLEVLETV-EIQRVVDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGV----ESNVARIVTFDGDREEAFAGEAITLVLTDEIDISRGDLLLDEALPAVQSASVDVVWM-AEQPLSPGQSYDIKIAGKKTRARVDGIEVENLPLNGIGLVDLTFDEPLVLDRGGLIFIDNVTVGAGMVHEPVSQATA 443
10 -50.800[J] KOG0458 Elongation factor 1 alpha  ali follow..  17  68.......ESTLAELKKTLKKKKTPKKPIAAANGSANVTQKLANISISQQRPNDRLPDWLDEEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLY----DLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSH-FSTHRANFTIVDAPGHRDFVPNAIMGIS--QADMAILCVDCSTNAFGQTKEHMLLASSLGIHNLIIMNKMDNVSQQRFEEIKSKLLPYLVDIGFFEDNI---------------------NWVPISGFSGEGVPNLMSTLENAKENEGINKDDPFLFSVLEIIKTSNDLALVSGKLESGSIQPGESLTIYPSEQ----SCIVDKIQTNHEETDVAIKGDFVTLKLRKAYPIQNGDLAASSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARIKRLKIRHLGSKQRAFVEIELKRWIPLLTGRVVLRKGRTIAAGKISEI...... 609
11 -50.300[J] KOG0459 Polypeptide release factor 3  ali follow..  20  50.......................................................IPVPDEQEASEDHDEVMLHPVHNPAKAKEKAAQEKAAKEEAEDVAEANKKRHLNVVFIGHVDAGKSTIGGQILF----LSGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTNEEERLKGKTVEVGRAH-FETESTRFTILDAPGHKSYVPNMISGAS--QADIGVLVISARKGEFGQTREHVQLAKTLGVSKLIVVNKMDDPSKERYDEIEQKMVPFLKASGYNT------KKDVVFLPISGLMGKNMDQRMGQEICPWWSGPSFFEVLDSI-EIPPRDPNGPFRMPIIDKF--KDMGTVVMGKVESGSIREGDSLVVMPNKE----QVKVVAIYCDEDKVKRAGPGENLRVRITGIEDILSGFVLSVNPVPAVTEFVAQLQILEDNAIFTAGYKAILHIHAVVEECEIIELKVLFVKNGAAVVCRIQVTNSICIEKGRFTLRTGKTIAVGKVTELLSSVSS 531
12 -27.700[M] COG0481 Membrane GTPase LepA  ali follow..  18  6............................................................................................................NFSIIAHIDHGKSTLSDRLIQTC--SDREMEAQVLDSMDLERERGITIKAQSVTLNYKAK-----------------DGETYQLNFIDTPGHVDFSYEVSRSL--AACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDLPAAD-PERVAEEIEDIV--------------------------GIDAMEAVRCSAKTGVGIEDVLEEIVHKIPAPEGDPNAPLQALIIDSWFDNYLGVVSLVRIKNGTLRKGDKIKV-MSTGQSYNVDRLGIFTPKQVDTTILNCGEVGWCAIKDILGAPVGDTLTS.............................................................................................. 276
13 -25.100[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  22  7............................................................................................................NIAIIAHVDHGKTTLVDKLLSGTLDRKEAESERVMDSNDQEKERGITILAKNTAIKWN----------------------GYNINIVDTPGHADFGGEVERVM--SMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLRPIVVVNKIDRPGAR-PDWVIDQIFDLFDNLGATDEQLDF-------------------PIVYASALNGDNMDALFQAIIDHVPAPVVDTEGPFQMQISQLDYNSFLGVIGIGRITRGKVKSNTPVVAI-SDDGSKRNGRILKI-LQRVEVAEAEAGDIVC--VSGMEELFISDTLCDPQ............................................................................................ 292
14 -24.500[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  20  44............................................................................................................NFGIVAHVDHGKSTLADRLLE-MCGAVPPGQKQMLDKLQVERERGITVKAQTAALRHR----------------------GYLLNLIDTPGHVDFSAEVSRSL--AVCDGILLLVAANQGVQAQTIANFWLAFEKNIQIIPVINKIDLPGAD-IKSVETQLKNLFEFNP--------------------------EECLHISAKSGLNVDKVLEAIIDRVPAPTAIIDAPFRSMIFDSYFDHFRGAIAHIMVKEGSVKKGDKIQSYQNEKVYDVSEVMRPEMVKCTELRAGQVGYLVC-NMRTVNEAVVGETLFAET............................................................................................ 309
15 -24.200[J] KOG0468 U5 snRNP-specific protein  ali follow..  15  17.LDSDEEDEQSIYGQPDVQDDPEDAMDEDEVEPQEDEDKEVTAVVLHEDKRYYPSAVEVYGPDVETIVQEEDAQPLDKPLIEPVKKLKFQIKEQDMQETTYDMEFMA-NVALVGHLHHGKTTFVDCLTHPQFETMEERQLRYTDTLFTEQERGCSIKATPVTLVLQDV-----------------KQKSYLLNIFDTPGHVNFSDEATAAM--RMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILEKLKHIVEEVNGLLSTYGAPDDNLLVSPILGNVCFASSLYGSNIRPLLRLVCNRFMGDGFVDMCVEHIKSPLENNQYGTLMVHSSKMYPNDDTFFQVLARIVSGTLHAGQEVRVTLQDEEDSRILQVGRLWVYKVELNRVPAGNWVLIEGIDQCIVKTSTIVDINVPEDLYIFRPLKFNTQSIIKIA-----------------VEPVNPSELPKMLDGLRKVNKSYPLL-ESGEHVI-----LGTGEL......... 638
16 -23.500[J] KOG0469 Elongation factor 2  ali follow..  16  21............................................................................................................NMSVIAHVDHGKSTLTDSLVAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETV-KYNGFLINLIDSPGHVDFSSEVTAAL--RVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLE-LQLGAEELFQTFQRIVENINVIIATYGDDDGPMGPIMVDPSIGNVGFGSGLHGWAFTMLQMIAFHLPSPVTAQNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARI-PGKKEDLYEKTIQRTILFIEPIEDIPSGNIAGLV--------DQYLVKGGTITTYKDAHNMRVMKFSVSPV--------------VRVAVEAKNPADLPKLVEGLKRLAKSDPMV-ESGEHII-----AGAGEL......... 546
17 -23.100[J] COG4108 Peptide chain release factor RF-3  ali follow..  17  17............................................................................................................TFAIISHPDAGKTTITEKVL-GTVKGRGSNQHAKSDWMEMEKERGISVTTSVMQFPYG----------------------DCLVNLLDTPGHEDFSEDTYRTL--TAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDREIRD-PMELMDEVENELKIACSP-EELELVLGASHEFDRELFLQGELTPVFFGTALGNFGVDHMLDGLTQWAPSPSEEKFTGFVFKIQANMDPKHRDRIAFVRIVSGTYKQGMKMNHVRLGKQVNISDAVTFMAGDRARAEEAFAGDIIG--LHNHGTIQIGDTFTQGE............................................................................................ 385
18 -22.000[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  19  98....................TIEELARAMEKNTDY---EALLNTDIDID-----SLEADSHLDEVWIKEVITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTP-VVTIMGHVDHGKTTLLDKFRKTQVAAVET---------------GITQHIGAFLVSLPSG---------------------EKITFLDTPGHAAFSAMRARG--AQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEAD-----PEKVKKELLAYDVVCEDY-----------------GGDVQAVPVSALTGDNLMALAEATVALAEM-KADPNGPVEGTVIESFTDKGRGLVTTAIIQRGTLRKGSVLVAGKC-------AKVRLMDENGKTIDEAYPSMPVGIGWRDLPSAGEEILEVESEPRAREVVDWR.................................................................................. 447
19 -19.900[E] COG4917 Ethanolamine utilization protein  ali follow..  22  3............................................................................................................RIAFVGSVGAGKTTLFNALQG------------------NYTLARKTQAVEFN------------------------------KGDIDTPGHPRWYHALITTL--QDVDMLIYVHGANDPESRLPAGLLDI--GVSKRQIAVISKTDMPDAD-----VAATRKLLLETGFEE------------------------PMFELNSHDPQSVQQLVDYLASLTKQEEAGEK..................................................................................................................................................................................... 154
20 -19.200[R] KOG2486 Predicted GTPase  ali follow..  18  137............................................................................................................EFALVGRSNVGKSSLLNSLVR----------RKRLAL--TSKKPGKTQCINHFRI-------------------------NDKWYLVDLPGYNKFTKDYFLNR--STLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANI------------------KEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH....................................................................................................................................................................................... 318
21 -18.600[R] COG0218 Predicted GTPase  ali follow..  20  27............................................................................................................EIALAGRSNVGKSSFINTML-----NRKNLARTS-------GKPGKTQLLNFFNI-------------------------DDKMRFVDVPGYEEYLTT------RENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNF-------------------------DPSDDFILFSSVSKAGMDEAWDAILEK.............................................................................................................................................................................................. 194
22 -18.500[J] COG0480 Translation elongation factors (GTPases)  ali follow..  15  12............................................................................................................NIGIAAHIDAGKTTTTERILFGEVHEGTAVT------MDQERERGITITAAAISTSWK----------------------DYQINIIDTPGHVDFTIEVERSM--RVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPRIAFINKMDRTGAN-FYRVHEQMRDRLRANAITKLVEAVAETDDDLMSKKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTRADDNEPLAALAFKIMADPYGRLTFVRVYSGVLKKGSYVLNATKNKKERISRLVLMKADDRQDVEELRAGDLGA--ALGLKDTLTGDTITDEGAP------VILESLFIPEPV--------------ISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGEL......... 453
23 -17.800[J] KOG0465 Mitochondrial elongation factor  ali follow..  12  72............................................................................................................NIGISAHIDSGKTTFTERVLYHEVRGRDNVG-AKMDSMDLEREKGITIQSAATYCSWDK------------------EGKNYHFNLIDTPGHIDFTIEVERAL--RVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPRVTFINKMDRMGSD-PFRAIEQLNSKLKIPAAQLLIETLADVDDEMAEMRSTIARSFTPVLMGSALANTGIQPVLDAIVDYLPNPVPAVQQPFVGLAFKLEE-GKYGQLTYVRVYQGRLRKGNYITNVKTGKKVKVARLVRMHSSEMEDVDEVGSGEICA--TFGIDCASGDTFTDGSVQYSMSSMYVPDAVVSLSITPNSKDASNF----------------------SKALNRFQKEDPTFRVKFDPESKETIISGMGEL......... 519
24 -17.500[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  19  367....................NVQDIAKSIKREPAE---KKLFMMGT--------MVNQNQSLDEDTIELILMDYGVTPVKKVEEDKSDIERLFVEDGYLKEENMVER-VVTIMGHVDHGKTTLLDRFRESRVTEGEA---------------GITQHIG----------------------AYQIKANGKKITFLDTPGHEAFTSMRARG--ASVTDITILVVAADDGVMPQTIEAINHSKAAGVPIIVAINKIDKPGAN--QRVTQELTEH--------------------VFPVAWDPENGSEFVEISAKFNQNLDELLDTVLLVAEV-KADPTVRAIGTVVEARLDQGKGAIATLLVQQGTLHVQDPIVVGNT--------RVRTMNDLGRRIKEAGPSTPIELGLSDVPQAGDHFAVFEDEKAARAAGEERAKRAQLIKRQNTRRVNLDNLFDTLKEGQTKSVN--IIKADVQGSAEALAASLQKIEVEGVKVD----SAVGAISE....... 786
25 -17.000[R] COG1084 Predicted GTPase  ali follow..  14  93.............ALNWAVGILNQLESDYMARIKRSKPSDASHLRREAFGRISSVIKRIEGDLDFLDFAKNK------------------------LRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLTGA--------------EPEVADYPFTTKGIQIGHLERK----------------------WKRIQVIDTPGLLDRPVEDMNNILENIADVIMFIFDASETCGYTLESQYSLYLVFDIPVVTVFNKMDLAENVKYLEEYINMVE---------------------------------DPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDNV.................................................................................................................................................................................. 336
26 -14.900[R] COG3596 Predicted GTPase  ali follow..  13  26..............................................................................................RILQQINQLTHYEPVIGIMGKTGAGKSSLCNALFAGEVSDVAACTRDPL--------------------------------------RFRLQIGEHFMTIVDLPGDTEYAALYREQL--PRLDLILWLIKADDRALATDEHFYRQVIGYRHKMLFVISQSDKAEPTSGGNILSTEQK---------------QNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERM................................................................................................................................................................................................. 212
27 -13.900[R] COG1160 Predicted GTPases  ali follow..  14  98....AADIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTSEEDTALIDDALDEELEEEQDKNIKIAIVGRPNVGKSTLTNRILGEDVFDMPGTTRDSI--------------------------------------YIPMERDGQQYTLIDTAGVRK-VIKTLQAI--QDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKSELDRRLDFIDF-------------------------ARVHFISALHGSGVGNLFDSIKEAYACATQKMTTS................................................................................................................................................................................... 395
28 -13.600[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  17  51......................................................................................................RRTKSNTVLLSGLSGSGKTVLFYQLRDG------------------SSHQGAVTSMEP-----------NEGTFVLHNENNTKKGKVKPVHLIDVPGHSR-LISKLEEYLPRAAAVVFVVDALELPNIRAASEYLYDILT-KTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIEGEVFSFSHCVAEASGLTGETDQVQEFIREHVKP........................................................................................................................................................................................... 260
29 -13.400[P] COG0370 Fe2+ transport system protein B  ali follow..  19  1........................................................................................................MSQNTYCILGNPNTGKTSLFNALTGSYEYVGN---------------SGVTVEKKVGTL------------------------RSKTGKLIDLPGDETVVTRFL---LEEKFDCMLNIVDSSQ-----IERNLNLTVQLGAPVVMGLNMIDVAAGRGIHLNIQNLAKKLR-----------------------------IPILPVVARSGKGTEDILSTLSEKHVAPAIPLVLQYGEPAEKAIK......................................................................................................................................................................... 181
30 -13.200[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  15  88........NKDHYKLALGQ------VNTARNLISKISKDYVKLLKYGDS-----RCKCLKVAALGRMCTVLKRITPSLAYLEQIRQHMARLPSIDPNTRT---------VLICGYPNVGKSSFMNKVTR---------ADVDVQPYA------TTKSLFVGHTDYKYLR----------------------YQVIDTPGDRNIIEMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIK-PLVIVCNKTDLMPMENISEEDRKLIEEMKSEAMK----------------TAMGASEEQVLLKMSTLTDEGVMSVKNAA................................................................................................................................................................................................. 345
31 -13.100[R] COG2229 Predicted GTPase  ali follow..  19  1........................................................................................................MRENKIIFTGPVGVGKTTAIAAIS----DEALVQTDASASDMTLDRKRNTTVAMDYGAISLDEDTK---------------------VHLYGTPGQERF-EILSQGSMG----LVLLLDNARTNPLKDLEFFLHSFRGLKAPVVVGITKMDIRSQPGIDVYHKYLAK----------------------------HNLNVPVFEIDARKEDDVKQLVSAM................................................................................................................................................................................................. 168
32 -12.200[T] KOG3886 GTP-binding protein  ali follow..  33...................................................................................................VLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATI------LDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDRNVEVLIYVFDVESRELEKDMHYYQSCLEADAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRL-----------------------SRPLECSCFRTSIWDETLSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFERATFLVISHYQCKEQRDAHRFEK----SNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVVSDPSIPSAATLINIRNARK............................................................................ 356
33 -11.900[R] COG1159 GTPase  ali follow..  12  11.............................................................................................................IAIVGRPNVGKSTLLNKLLG---------QKISITSRKAQTTRHRIVGI--------------------------HTEGPYQAIYVDTPGLHMEEKRAINRLMNKAAELVIFVVEGTRW-TPDDEMVLNKLRDGKAPVILAVNKVDNVQEK--VDLLPHLQFLASQMNFLD-------------------------IVPISAETGMNVDTIAGIVRKHLPEAIHHFPEDYITDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVTNERGGYDINGILVEREGQKKMVIGNK-GAKIKTIGIEARKDM................................................................................................. 265
34 -11.200[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  15  5...........................................................................................................LIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITYTKEDARILLNTSVLPADRIAGVETGIREDASMNFAAIEEMCDKHPDLQLLFLESGG------NLSATFSPDLVDFSIYIIDVAQGEKIPRKG------GMIKSDLFIINKVDLAPYVGAN--VEVMKADTLKSRGN------------------------KDFFVTNLKTDEGLKSVADWIEK............................................................................................................................................................................................... 197
35 -10.900[R] KOG1533 Predicted GTPase  ali follow..  12  23................................................................................................GENLGSTHWTMYGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGAL--LQKIEANHKKYLIIDCPGSEGELWKVIRFLEKSGVRLCALHLSDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYDLEFFSHLPRLLDLLNEVPGLEKYRKLNEAICGVISDFDLVSFVPLAVENKESMMKVIQMVDAA.............................................................................................................................................................................................. 280
36 -10.500[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  10  23.........................................................DQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEVRHMKVAFFGRTSSGKSSVINAMLWDKV-EGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAKCALLRDDLVLVDSPGLDSWIDKFCL-----DADVFVLVANSESTLMNTEKHFFKVNEWLSKPNIFILNNRWDASASEPEYMEDVRRQHMER.................................................................................................................................................................................................................................................. 259
37 -10.500[K] KOG1534 Putative transcription factor FET5  ali follow..  13  1........................................................................................................MVKVAAFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVMEELDYGPNGGL--NEEIGDYDEDYLIFDMPGHVPILPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAAMVMMEVPHINLLSKMDLLKDNNNITKAELKRFLNTDPLLLTGEINETTNPKFHELNRCIVQ-NMVNFLPLESGNEESVSRVLSYIDDA.............................................................................................................................................................................................. 252
38 -10.300[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  12  1..................................................................MDPMESSSEQDIVEESQKLVDSLDKLRVSAASSSSNFKKKPIIIIVVGMAGSGKTSFLHRLVCVNLDPAV-RDTVKYKEVMKQYNLGPNGGILTSLNLFATKFDEVVSVIEKRA-------DQLDYVLVDTPGWSASGAIITEAFASTFPTVVTYVVDTPRSSSPIT---CSILYKTRLPLVLAFNKTDVADHKFALEWMEDFEVFQAAIQSDNSYTATLANSLSLSLYEFYRNIRSVGV---SAISGAGMDGFFKAIEA----SAEEYMETYKADLDMR........................................................................................................................................................................... 298
39 -10.200[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  11  11.......................................................QDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGLRRSGKSSIQKVVFH----------------------------------KMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFD----RGTGALIFVIDSQDDYMEALARLHLTVTRADINFEVFIHKVDGLSDDHKIETQRDIHQRAND------------------DLADAGLEKIHLSFYLTSIYDHSIKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIAT.............................................................................................................................................................. 273
40 -10.100[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  18  14.......................................................................................................KKEQYSILILGLDNAGKTTFLETLKK-----------EYSLAFKALEKIQPTVGQNVATIPVD---------------------SKQILKFWDVGGQES-LRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHI-----------------------SARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPIYK................................................................................................................................................................................. 198
41 -10.000[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  18  18........................................................................................................KEEMELTLVGLQFSGKTTFVNVIASG------------------QFAEDMIPTVGFNM--------------------RKITRGNVTIKVWDIGGQPR-FRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLLAGIPVLVLGNKRDLPGALDETGLIERMN--------------------------SSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR........................................................................................................................................................................................ 186
42 -9.980[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  19  18........................................................................................................QKEAKILFLGLDNAGKTTLLHMLKDERLVQ-------------------HQPTQHPT--------------------SEELSIGKIKFKAFDLGGHQI-ARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLLATVPFLILGNKIDIPYAASEDELRYHLG-------------LTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWL................................................................................................................................................................................................. 188
43 -9.960[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  13  40......................................................GGDSSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGDRGYDFTGVLEWFAERVDRIILLFDAHK--LDISDEFKRCIEALA-KIRIVLNKSDMVDHQQLMRVYGALMWSLGK.................................................................................................................................................................................................................................................. 276
44 -9.770[R] COG2262 GTPases  ali follow..  18  116....RTHEGKLQVELAQLRHLATRLVRGWTHLERQKGG-----IGLRGPG------ETQLETDRRLLRNRIVQIQSRLERVEKQREQGRQ----------SRIKADVPTVSLVGYTNAGKSTLFNRITEARV-----YAADQLF------------------------------ATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRLLLHVIDAADVRVQENIEAVNTVEIPTLLVMNKIDMLEDFEPRIDRDE--------------------------------ENKPIRVWLSAQTGAGIPQLFQALT................................................................................................................................................................................................ 358
45 -9.670[R] KOG0410 Predicted GTP binding protein  ali follow..  19  232...........EAALQVALAQMEYQLPRLT-HLERQSG-----GQVKGMG------EKQIEVDKRILRTQIGVLKKELESVRKHRKQYRS----------RRVAIPVPVVSLVGYTNAGKSTLLNQLTGANV-----LAENRLF------------------------------ATLDPTTRRVQMQNGKEFLLTDTVG---FIQKLPTTLVAAESSLLVHVVDISHPLAEQQIEAVKVMSELDVPKLVVWNKVDRVDDPQKVKLEAEETG---------------------------------DTICISALTGEGLDDFCNAVH................................................................................................................................................................................................ 469
46 -9.590[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  13  2......................................................INEATLAESIRRLRQGERATLAQAMTLVESRHPRHQALSTQLLDAIMPYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSSPVTGGSILGDKTRMNDLARAEAAFIRPVPSSGHLGGASQRARELMLLCEAAGYDVVIVETV-GVVARMVDCFISLQIAGGGDDLQGIK----KGLMEVADLIVINKDDGDNHTNVAIARHMYESALH-------------------ILRRKYDEWQPRVLTCSALEKRGIDEIWHAII................................................................................................................................................................................................ 254
47 -9.150[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  11  1.............................................................................................MWMGVGDSSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHP-------------------------------------IPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGKVVKEV--RQADAIVLTFAFDR---PETLDRLS--LEVRVPIIVAGYEVDNKEAYNHFSIEQITSALMKQY------------------------REVETSIQWSAQRLDQAKDVLYYAQKVFDQENNVLKPRCIAALKRIFLLSDHN---DGILSDEELN....................................................................................................................................................... 221
48 -9.090[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  16  15........................................................................................................DQEVRILLLGLDNAGKTTLLKQLASEDISH-------------------ITPTQGFNI--------------------KSVQSQGFKLNVWDIGGQRK-IRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLLSCVPVLIFANKQDLLTA----APASEIAEGLNLHTIRDRVWQ---------------------IQSCSALTGEGVQDGMNWVCKNVNAKKK........................................................................................................................................................................................ 182
49 -9.070[J] KOG1191 Mitochondrial GTPase  ali follow..  13  245......EPGEFTLRAFLN-GRLDLSQAENVEKLISAKSSAAADAALEG---IQGGFSSLVKSLRAQCIELLTEIEARLSVINKITSMSQDVESALDTANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSEVTEVAGTTRDVV--------------------------------------EANVTVRGVPITLLDTAGIRETNDIV-IGVERSVADVIIMAVSAVEGWTEEDTELLRKIQS-KQPMILVMNKIDCAPPGSCDQLEDQRKKEEVFH----------------------------KSVFTSAVTGQGIEELEDAILEI--------------------------------LGLDRVPTGGHQWTVNQRQCEQLVRTKEALVRLREAIEDEIPIDFWTIELREAALSLAQISGQDVSEEVLSSIFAKFCI............................................................................... 611

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.