current user: public

If you have questions about the server, please let us know.

Query: [H] COG5424 Pyrroloquinoline quinone (Coenzyme PQQ) biosynthesis protein C, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MSEFFDRTGPLQEAGSYPQWAQQLIVDCQASKDRVSGHELYRRMRDAELSPALMRLYLIGGWPVVEQFPLYMSQNLLKTRFARHPGEDMARRWLMRNIRVELNHADYWLHWAEAHGVSLAEIQAQDVPAELHALSHWCWHTCASDSLAVAMAATNYAIEGVTGEWSALVCSNGVYENAFPKEGRKRAMKWLKLHAQYDDAHPWEALEIICTLAGTNPSAELRRQLRDAICKSYDYMYLFLERCMQLEEARSARKLAVGAELast
1 -105.000[H] COG5424 Pyrroloquinoline quinone (Coenzyme PQQ) biosynthesis protein C  ali  100  1MSEFFDRTGPLQEAGSYPQWAQQLIVDCQASKDRVSGHELYRRMRDAELSPALMRLYLIGGWPVVEQFPLYMSQNLLKTRFARHPGEDMARRWLMRNIRVELNHADYWLHWAEAHGVSLAEIQAQDVPAELHALSHWCWHTCASDSLAVAMAATNYAIEGVTGEWSALVCSNGVYENAFPKEGRKRAMKWLKLHAQYDDAHPWEALEIICTLAGTNPSAELRRQLRDAICKSYDYMYLFLERCMQLEEARSARKLAVGAE 260
2 -51.200[K] COG0819 Putative transcription activator  ali follow..  11  1..........................QVVPAWKEYINHKFTNMLAKGTLPLPAFQDYLKQDYLYLVNFARAYSLKGYKENTFPNI------LEAAQSVIHVIEEKELHVSMCSSYGVSLQDLKSCEESPACTAYSRYILDTGAAQDVAALDFVQAPCL-IGYYVIAARLMKE-------FRNPQGPYQKWVDNYFCEDYLSAVRRGCRQIEEIVLKLSPERIQELIEIFIRATKFETLFWETPYYEYVTKQNLEDKEFS. 220
3 -20.500[HK] KOG2598 Phosphomethylpyrimidine kinase  ali follow..  12  357....................YLINHPKVKPHWDAYVNHEFVKRVADGTLERKKFQFFIEQDYLYLIDYVRVCCVTGSKSPTLEDLEKDLVIADCARN--ELNEHERR---LREEFGVKDPDLQKIKRGPALRAYCRYLIDISRRGNWQEIVVALNPCLMG-YVYAVDKVKDKI------TAAEGSIYSEWCDTCASSFCYQAVLEGERLMNHILETYPPDQLDSLVTIFARGCELETNFWTAAMEYE............. 572
4 -16.700[P] COG5398 Heme oxygenase  ali follow..  2................SSNLANKLRVGTKKAHTMAENVGFVKCFLKGVVEKSSYRKLVANFYYVYSAMEEEMEKHSQH-------------PIVSKINFSQLNRKQTLEQDLSYYYGANWR-EQIQLSPAGEAYVQRIREISATEP--ELLIAHSYTRYLGDLSGGQILKNIAVTAMNLN---DGQGTAFYEFADISDEKAFKA--KYRQTLDELAIDEATGDRIVDEANAAFGMNMKMFQELEGTRKRTRGATELATAE 238
5 -14.000[S] COG2833 Uncharacterized protein conserved in bacteria  ali follow..  10  1MTDKPTYEQTLRG------NAIRAISACDLDEKVRLARETASRWFARALSEHGRIALMHALAHIELNAIDLALDIVARFAVKPIPRSF--FDGWMKVADDEARHFTLLRNRLKSLGADYGDMPAHDGL--------WQSAHQTRNDLEARLAVVPLILEARGLDVTPSLLEKMIET------GDHETAAILNIIYNDEKTHVAVGAKWFRFFCARNRIDPAKPPFNELARAEAGLTPSFYRSLSPVS............. 274
6 -12.000[P] COG3230 Heme oxygenase  ali follow..  19IIMMTSAEPAAPVAEIEQSRVKRLKAATRGAHGDLDSFIM---AAKPFESRENFGKFVETQYLFHRDLDVFFSNVTLDGLLPD----------------KGRRRLAMIEQDLADLGHAIPDTDEPRFTAEMPF--------------LPEAMGWLYVVEGSN---AAFLLKDAAKLG-----GEEFGARHLAGAPEGRGLHWRTFTAALDEI---SLTVQEEERVVAGAEAAFRAVHAYAQQRM................ 223
7 -11.200[P] KOG4480 Heme oxygenase  ali follow..  56.ATTAAEKQKKRYPGESKGFVEEMRFVAMRLHTKDQAEIEERPVAKWEPTVEGYLRFLVDSKLVYDTLELIIQDSNFPTYAEFKNTGLERAEKLSTDLE-----------------FKEQGYEIPEPTAPGKTYSQYLKELAEKDP--QAFICHFYNIYFAHSAGGRMIGRKVAERI-----LDNKELEFYKWDG--ELSQLLQNVREKLNKVAEEWTREEKNHCLEETEKSFKYSGEILRLI................. 280
8 -8.320[S] COG3396 Uncharacterized conserved protein  ali follow..  12  1....MTQEERFEQRIAQETAIEPQDWMPDAYRKTLIR--QIGQHAHSEIVG-----------------MLPEGNWITRAPTLRR------KAILLAKVQDEAGHGLYLYSAAETLGCAREDIYQKMLDGRMKYSTLSWADIGVIGWLVDGAAIVNQVCRTSYGPYARAMVKICKE----------------------ESFHQRQGFEACMALAQG--SEAQKQMLQDAINRFWWPALMMFG................... 196
9 -6.620[S] COG1633 Uncharacterized conserved protein  ali follow..  1.......................MKSAYKETIEEVRNLKGIEEAIALAIDREK----AREFYLQQ----------------AGLMENPKFKELYEELAAEEMKHLGYLENYRDKKELPEISTEVPSGQSFSPEFDASRTKVGEITLGDAGILLAAMRHERKSEDFYSEMAKRVE---------DETQKKFFEMLSRYERGHYEVIDSYLEYITQFR............................................ 165
10 -6.590[FJ] COG4445 Hydroxylase for synthesis of 2-methylthio-cis-ribozeatin in tRNA  ali follow..  11  19YPQILSPVLNFLHCPTPQAWIVQARDP-QNLPLLLTDHLIC-ELKAAQTALLLVRKYVADDFVALHKQISKSAMPQTDDPWGRQLIDRMVLL-----IKEELHHFWQVREVMQARNIPYVKITASR-------YAKGMLKAVRTHEPLTLIDKLICGIEARSCERFAALAPWL----------DEDLQTFYLSLLRSEARHYQDYLALAQQISAEDISARVRY..................................... 244

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.