current user: public

If you have questions about the server, please let us know.

Query: [S] COG5452 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MIFGLFKKKSGNIAIVKRQYAALTAAARQPFLYTDLDVPDTVMGRFEMLSAILILYFRRTRSSARAGQEIAQEIVDAFFEDVDHSIRELGVGDASVPKKMKKLAGMFYGRLESYAAALEGRDAGALAAALRRNFHADVEDAPSMRGLASYLLAVESVLSDTAEEAVETGQLRIPPAGTLast
1 -86.000[S] COG5452 Uncharacterized conserved protein  ali  100  1MIFGLFKKKSGNIAIVKRQYAALTAAARQPFLYTDLDVPDTVMGRFEMLSAILILYFRRTRSSARAGQEIAQEIVDAFFEDVDHSIRELGVGDASVPKKMKKLAGMFYGRLESYAAALEGRDAGALAAALRRNFHADVEDAPSMRGLASYLLAVESVLSDTAEEAVETGQLRIPPAGT 178
2 -63.900[C] KOG2873 Ubiquinol cytochrome c reductase assembly protein CBP3  ali follow..  23  130.MMMFYSKQSMSIRGANVIYKRIIAQVDKPAIYDVFNLEKTFKITYSLLVLHMWLVLRRLKEDGQEGVDLGQYVYEIYNHDVELRVSKAGV-NLLLAKWMKELERIFYGNVVAYDAALLPEAPNDLQIKLWRNVFSDDGDLKTAQAMARYVRRELGSLSLTGTYDAIVGMPHYVTRIC 313
3 -5.590[Z] KOG1830 Wiskott Aldrich syndrome proteins  ali follow..  11  3......................LVKRNIEPRHLCRGALPEGITSELEVTNSTLAAIIRQLSSLSKHAEDIFGELFNEAANSLQDRIDRLAVKVTQLDSTVEEVSLQDINMKKAFKSSTVQDQQVVSKNSI-ADIYNQSDKPPPLNILTPYRDDKKDGLKFYTDPSYF........... 157
4 -5.330[T] COG4564 Signal transduction histidine kinase  ali follow..  11  210.....LRERRMADTKLKELAQRIIDTQEEERARLARELHDGISQNLVGVRYAIDLASRQVRTGSGGAPQAIEKASDALVRRLSHDLRPRILDDLGLTVALKALCERTGIETRFKADSLQETIKPEPSTALYRVV------QEALTNVERHSGATRVDIRLKGAHGKVTMTIA...... 376
5 -5.150[L] COG3436 Transposase and inactivated derivatives  ali follow..  13  308LQADAYAGFNELYRNGGITEAACWAHARRKIHDVHVRIPSALTEEALEQIGQLYAIEADIRGMPAEQRLAERQLLKSLESWLREKMKTL-SRHSELAKAFAYALNQWPALTYYANDGWVEIDNNIAENALRKNLFFGSDHGGERGALLSYLRHVLGVIADWPVNRV............ 499
6 -5.070[NU] COG3063 Tfp pilus assembly protein PilF  ali follow..  76..RAEIYQYLKVNDKAQESFRQALSKPDSAEINNNYGW----------------FLCGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQ--------FGLAEAYLKRSLAAQPQFPPA---FKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLG......... 216
7 -5.010[NU] COG1705 Muramidase (flagellum-specific)  ali follow..  10  55.FIQSIASDAQDLQKEEKILTSVLAQAILESNWGESGLSTSANNLFGI----------KGSYEGSSVSMGTQEFSNGKAYHTQADFRKYPDKKSSLVDHAQLFINGVSGNPDLYSAVIGETDYKKAAHAIQDAGYATDPT---------YAEKLISTIETYNLDDY............ 201
8 -4.970[KT] COG1842 Phage shock protein A (IM30), suppresses sigma54-dependent transcription  ali follow..  10  29........................................................................RMLEQHIRDAKAELDKA-ARVKLSHDKLKDLRERKASLEARTLEALSKNVNPSLINEVAEEIARLENLITAEEQVLSNLEVSRDGVEK.................. 123
9 -4.840[S] COG1633 Uncharacterized conserved protein  ali follow..  18.IEEAIALAIDREKEAREFYLQQAGLMENP------KFKELYEELAAEEMKHLGYLENYRDKKELPEISTEVPSGQSFSPEFDASRTKVGEITLGDAGILLAAMRHERKSEDFYSEMAKRVEDETQKKFFEMLSRYERGHYEVIDSYLEYITQ......................... 163
10 -4.840[S] KOG3930 Uncharacterized conserved protein  ali follow..  16  12...............................FFNAAGIPSPAAAGYAHVFV-------------------ENRIQDDMLLDLNKELREMGIGDIAILRHSKTVCEQ........................................................................ 72

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.