current user: public

If you have questions about the server, please let us know.

Query: [S] COG5469 Predicted metal-binding protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MTTDNSLGVAEHTLFVCKTCASVWQDGKRVGESGGQKLLNQLQQLAQEWELRDKFPIQEVECMSACNRSCVVAFTGKGKLTYLFGDLAVDDHASAVLECAGKYYDKADGLLPWSERPEPLKKGILARIPTLast
1 -70.100[S] COG5469 Predicted metal-binding protein  ali  100  1MTTDNSLGVAEHTLFVCKTCASVWQDGKRVGESGGQKLLNQLQQLAQEWELRDKFPIQEVECMSACNRSCVVAFTGKGKLTYLFGDLAVDDHASAVLECAGKYYDKADGLLPWSERPEPLKKGILARIPT 130
2 -27.600[C] COG3411 Ferredoxin  ali follow..  13  188.IPFSKNPLKHSYISVCTS-------TRCLPSRKWQPTFDALKSAVENAGL--DIEVRTSGCLEVCQLGPVVFYSNDRTW---YTRVNPNVAENIVNEHLIKGNKITENLYPPQT............... 289
3 -17.300[C] COG1905 NADH:ubiquinone oxidoreductase 24 kD subunit  ali follow..  13  88......QPVGRHVIRYCDS--------VVCHITGYQGIQAALEKKLSQTTFDGRFTLLPTCCLGNCDRGPTMMIDDD-----THSYLKPEEIEKLLEQY............................... 171
4 -15.100[C] KOG3196 NADH:ubiquinone oxidoreductase, NDUFV2/24 kD subunit  ali follow..  22  113.TMFMRKPTGKYHIQVCTT--------TPCWLRGSDDILETCKKQLGDTTKDRKFTISEVECLGACVNAPMVAINDD-----YYEDLTSKD-MQDILNDLKADKISPPG..................... 210
5 -14.000[O] COG4759 Uncharacterized protein conserved in bacteria containing thioredoxin-like domain  ali follow..  133.QTYQQPKNHIREIMVCTH----GNVDVACSRF-GYPIYQNLRQNYAAKSA-GQLRVWRCSHIGGHQFAPTLFDLPTGQF---WGHIEPEILDVLVWRNSKQLRQFYRGWSGMTKFEQIVEREIWMQH.. 252
6 -9.440[S] COG4844 Uncharacterized protein conserved in bacteria  ali follow..  13  2..........NPMIEFCVS-----------------NLAHGSQEARAILEKDPNLDVLEYGCLSYCGT-------MESLFALVNGEVVMGETPAELVENIYTFIEENP...................... 76
7 -9.050[P] COG0155 Sulfite reductase, beta subunit (hemoprotein)  ali follow..  10  421..MDDNVTSQRENSMACVTCPLAMAE----AERFLPEFVTRVEGILQQHGADEHIVLRVTGCPNGCGRALLAEVGLVGKAVGRYENITADEILLITDQLVGRWAKERHGDFVIRAGVIAPVIDSARDFYD 571
8 -7.570[C] COG2221 Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits  ali follow..  19  127...........WGINSCLTCTTAVVDSPS-----TKALGDALAPYFKEESLPAKLRIFVSGCPAMCAGGTAIDIAIVGQ................................................... 193
9 -6.740[K] KOG2906 RNA polymerase III subunit C11  ali follow..  15  13......YEGGGNSRFFCSTCPYVAYIQRQVEIKKKQLLVKKSIEAVVTKDDIPTAAETEAPC-PRCGHDKAYFKSMQIR................................................... 84
10 -6.700[OC] COG0526 Thiol-disulfide isomerase and thioredoxins  ali follow..  11  364.NFDDIVMDETKDVLVCGHCK---------------NLAPTYEKLAEEYSDDSNVVVAKIDATENDIS-PTIMFFKANDKVNPV-RYEGDRTLEDLSAFIDKHASFEPIKKEKESVPAPDLED....... 480

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.