current user: public

If you have questions about the server, please let us know.

Query: [S] COG5572 Predicted integral membrane protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MRGHDGYIVSSSPETGGLRGGEILFADHCNLGHPRNELSHDRAAQGRLGANPPGESLMTRTATTAALAAAIALSAGVSIAAADEHKAGAQTEKCYGVSKAGENDCKAGAGTSCAGTSKVDYQGDAWKMVKKGTCVTIKTPKGMGSLTPKALast
1 -101.000[S] COG5572 Predicted integral membrane protein  ali  100  1MRGHDGYIVSSSPETGGLRGGEILFADHCNLGHPRNELSHDRAAQGRLGANPPGESLMTRTATTAALAAAIALSAGVSIAAADEHKAGAQTEKCYGVSKAGENDCKAGAGTSCAGTSKVDYQGDAWKMVKKGTCVTIKTPKGMGSLTPKA 150
2 -8.400[R] COG3313 Predicted Fe-S protein  ali follow..  14  3....................ASIMFGVFVH-----------------LECSRPVGLVQAKLLLWALTASIMVIILFEEGEVAEQLEFFPVQSPCRGI-------CQSDERGFCRGCFRSRDERFNWNKMSDGEKQEV............. 96
3 -6.650[S] COG5480 Predicted integral membrane protein  ali follow..  14  19................................................RMEAVTQSSLALPRHFRHIARLFSAAALFLTPFIIVESAHADFRVC--------NSTQNLVGVAIGYRAQDGWVSEGWWQVPSSTCATLIEGELQSR..... 107
4 -6.020[K] KOG2691 RNA polymerase II subunit 9  ali follow..  2....................STMKFCRECNILYPKEDKEQKILLYACRNCDHQEVADNSCVYRNEVHHSVSERTQILTDVASDPTLPRTKAVRC--------SKCQHREAVFFQATARGEEGMTLFFVCCNPNCGH.............. 110
5 -5.990[S] COG5463 Predicted integral membrane protein  ali follow..  12  9......................................KTKMKRTKSIRHASFRKNWSARHLTPVALAVATVFMLAGCEKSDETVSLYQNADDCSAANPGKSAECTTA------NNALKEAERTAPKYATREDCVA.............. 101
6 -5.860[R] COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger  ali follow..  16  12...RDGEEFLRCPRCGMVFKRRKDYIKHVNKAHGWLFGRGKPKGK......................................................................................................... 53
7 -5.740[R] KOG4520 Predicted coiled-coil protein  ali follow..  30  3...........GSSRGGVRGGQDQFNDVKTDKQRENYLGNSLMA.......................................................................................................... 37
8 -5.490[S] KOG2521 Uncharacterized conserved protein  ali follow..  25  354.........NESVKPNGV--GQILF-DVY----PKNVEDWDIKLSETGRSRRRP................................................................................................ 393
9 -5.330[S] KOG4267 Predicted membrane protein  ali follow..  16  18..GLIGYLRKKSKVSGTALGANFAWASKLMERGSSQGINYAFYGSLVLLASSGPRFYKSRKPVPMILTVLGVISTW.......................................................................... 94
10 -5.330[S] COG5548 Small integral membrane protein  ali follow..  16  18..GLIGYLRKKSKVSGTALGANFAWASKLMERGSSQGINYAFYGSLVLLASSGPRFYKSRKPVPMILTVLGVISTW.......................................................................... 94

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24